DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8483 and crispld1

DIOPT Version :9

Sequence 1:NP_650264.1 Gene:CG8483 / 41623 FlyBaseID:FBgn0038126 Length:392 Species:Drosophila melanogaster
Sequence 2:XP_002937123.2 Gene:crispld1 / 100490431 XenbaseID:XB-GENE-989389 Length:514 Species:Xenopus tropicalis


Alignment Length:262 Identity:80/262 - (30%)
Similarity:114/262 - (43%) Gaps:51/262 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 ITAEERSIILQEHNRLRQIVATGRYPGQPGAENMREIVWDDELAARAQKWADNCQFRHDPHRTIN 96
            ||..:..:||..||:||..|       .|.|.||..::||.||...|:.||:.|.:.|.|...:.
 Frog    57 ITESDMKLILDLHNKLRGEV-------YPPASNMEFMIWDVELERSAEAWAETCLWEHGPADLLP 114

  Fly    97 RFTMGQNLAIIWSTAPLDADDGDF--PS-RIQSWFNEVQKYSFG-----DAW------SPKTGHY 147
              .:||||...|         |.:  |: .:|:|::||:.|:|.     |.:      .|...||
 Frog   115 --VIGQNLGAHW---------GRYRPPTYHVQAWYDEVRDYTFPYPQECDPYCPFRCSGPVCTHY 168

  Fly   148 SQLVWGETSLVGCGYAEYKDTSKYNKLY------VCNYGPGGNVVGYNPYEVGKPSCSTYGMKPS 206
            :||||..:|.:||......:.:.:.:::      ||||.|.||..|:.||:.|.| ||  ...||
 Frog   169 TQLVWATSSRIGCAINLCHNMNVWGQIWPKAIYLVCNYSPKGNWWGHAPYKHGHP-CS--ACPPS 230

  Fly   207 SRYQG-----LCAAPGSS---PAANSVYGANTIETYEYGYNSSPSSQTANNNPPTNNINKSQFSY 263
              |.|     ||...||.   |........|.||........:.|...|..|.||::.....|..
 Frog   231 --YGGGCKDNLCYKDGSDLHYPLPEPEEETNEIEGQSSKVLDTTSQSRARTNSPTSSTRVESFDN 293

  Fly   264 NQ 265
            |:
 Frog   294 NE 295

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8483NP_650264.1 SCP_euk 37..180 CDD:240180 48/162 (30%)
crispld1XP_002937123.2 CAP_CRISPLD1 62..207 CDD:349407 48/162 (30%)
LCCL 304..388 CDD:128866
LCCL 407..506 CDD:367672
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 78 1.000 Domainoid score I8613
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R6223
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.950

Return to query results.
Submit another query.