DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8483 and pi15

DIOPT Version :9

Sequence 1:NP_650264.1 Gene:CG8483 / 41623 FlyBaseID:FBgn0038126 Length:392 Species:Drosophila melanogaster
Sequence 2:XP_002937120.1 Gene:pi15 / 100489915 XenbaseID:XB-GENE-989406 Length:258 Species:Xenopus tropicalis


Alignment Length:266 Identity:75/266 - (28%)
Similarity:115/266 - (43%) Gaps:56/266 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MMQPSAVLLTTIMIISCEVAF---------ACNGKIIASGITAEERSIILQEHNRLRQI-----V 51
            |:..||..|.:::..:|.:..         |.|..||...::|...:..:.:..|.|.|     :
 Frog     4 MVSISAAFLLSLLCETCGLVLPKSSDLASAASNYTIIKPDLSARLDAAKVPKARRKRYISQNDMI 68

  Fly    52 ATGRYPGQ------PGAENMREIVWDDELAARAQKWADNCQFRHDPHRTINRFTMGQNLAIIWST 110
            |...|..|      |.|.||..:|||:.||..|:.||..|.:.|.|...: :| :||||::    
 Frog    69 AIVEYHNQVRGKVFPPAANMEYMVWDENLAKLAEAWAATCIWDHGPSYLL-KF-LGQNLSV---- 127

  Fly   111 APLDADDGDFPSRIQ---SWFNEVQKYSFG-----------DAWSPKTGHYSQLVWGETSLVGCG 161
                 ..|.:.|.:|   .|::||:.|:|.           ..:.|...||:|:||..|:.:||.
 Frog   128 -----RTGRYKSILQLVKPWYDEVKDYAFPYPQECNPRCPLRCYGPMCTHYTQMVWATTNRIGCA 187

  Fly   162 YAEYKDTSKYNKLY------VCNYGPGGNVVGYNPYEVGKPSCSTYGMKPSSRYQGLCAAPGSSP 220
            .....:.:.:..::      ||||.|.||.:|..||.:|.| ||  ...||  |.|.|:.....|
 Frog   188 IHTCHNMNVWGAVWRRAVYLVCNYSPKGNWIGEAPYTIGVP-CS--ACPPS--YGGSCSDNQCFP 247

  Fly   221 AANSVY 226
            ...|.|
 Frog   248 GVTSNY 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8483NP_650264.1 SCP_euk 37..180 CDD:240180 46/173 (27%)
pi15XP_002937120.1 CAP_PI15 67..212 CDD:349408 43/155 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 78 1.000 Domainoid score I8613
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R6223
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.950

Return to query results.
Submit another query.