DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8483 and R3hdml

DIOPT Version :9

Sequence 1:NP_650264.1 Gene:CG8483 / 41623 FlyBaseID:FBgn0038126 Length:392 Species:Drosophila melanogaster
Sequence 2:NP_001092801.1 Gene:R3hdml / 100043899 MGIID:3650937 Length:253 Species:Mus musculus


Alignment Length:202 Identity:67/202 - (33%)
Similarity:92/202 - (45%) Gaps:43/202 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 ITAEERSIILQEHNRLRQIVATGRYPGQPGAENMREIVWDDELAARAQKWADNCQFRHDPHRTIN 96
            |:|.:.|.:|..||.:|..|       .|.|.||..:|||::||..|:.||..|.:.|.|.:.:.
Mouse    58 ISARDMSALLDYHNHIRASV-------HPPAANMEYMVWDEQLARSAEAWATQCIWTHGPSQLMK 115

  Fly    97 RFTMGQNLAIIWSTAPLDADDGDFPS---RIQSWFNEVQKYSFGD--------AW---SPKTGHY 147
              .:||||:|         ..|.|.|   .::||..|.:.|||..        .|   .|...||
Mouse   116 --YVGQNLSI---------HSGRFRSVVDLVRSWSEEKRHYSFPAPKDCTPHCPWLCSGPVCSHY 169

  Fly   148 SQLVWGETSLVGCGYAEYKDTSKYNKLY------VCNYGPGGNVVGYNPYEVGKPSCSTYGMKPS 206
            :|:||..:|.:||........:.:...:      ||||...||.:|..||:.||| ||  ...||
Mouse   170 TQMVWASSSRLGCAINTCSSINVWGNTWQQAVYLVCNYAIKGNWIGEAPYKAGKP-CS--ACPPS 231

  Fly   207 SRYQGLC 213
              |||.|
Mouse   232 --YQGNC 236

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8483NP_650264.1 SCP_euk 37..180 CDD:240180 48/162 (30%)
R3hdmlNP_001092801.1 CAP_R3HDML 63..208 CDD:349409 48/162 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167841168
Domainoid 1 1.000 72 1.000 Domainoid score I9265
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm43032
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
76.750

Return to query results.
Submit another query.