DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8141 and SLX8

DIOPT Version :9

Sequence 1:NP_731776.1 Gene:CG8141 / 41622 FlyBaseID:FBgn0038125 Length:239 Species:Drosophila melanogaster
Sequence 2:NP_011041.3 Gene:SLX8 / 856852 SGDID:S000000918 Length:274 Species:Saccharomyces cerevisiae


Alignment Length:119 Identity:28/119 - (23%)
Similarity:49/119 - (41%) Gaps:17/119 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 NETAENPSHGLQGEVI---------SKGYIPDLSNANVN---QQQQQENDGEDDLLPGTRLRYRR 75
            ::||..||.....:..         ||....||:...::   ::||.....:||....|:...:.
Yeast   133 SQTANTPSASPMLDAAPPTTKPGTNSKEQTVDLTADAIDLDAEEQQVLQISDDDFQEETKEAPKE 197

  Fly    76 RNLHLDPYVCNECNQYVRGGVITICGHLFCWTCLWPKLSGTAQPR----CPCCQ 125
            .....| |.|..|.:.....::|:|||:||..||:..::.:...|    |..|:
Yeast   198 YGAAKD-YRCPICFEPPETALMTLCGHVFCCPCLFQMVNSSRTCRQFGHCALCR 250

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8141NP_731776.1 zf-C3HC4_2 85..124 CDD:290634 12/42 (29%)
SLX8NP_011041.3 PEX10 1..264 CDD:227861 28/119 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S2074
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000717
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.860

Return to query results.
Submit another query.