DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8141 and AT1G19310

DIOPT Version :9

Sequence 1:NP_731776.1 Gene:CG8141 / 41622 FlyBaseID:FBgn0038125 Length:239 Species:Drosophila melanogaster
Sequence 2:NP_564078.1 Gene:AT1G19310 / 838513 AraportID:AT1G19310 Length:226 Species:Arabidopsis thaliana


Alignment Length:125 Identity:35/125 - (28%)
Similarity:55/125 - (44%) Gaps:31/125 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 IPDLSNANVNQQQQQENDGEDDLLPGTRLRYRRRNLHLDPYVCNECNQYVRGGVITICGHLFCWT 107
            :|..|:.|........|                       :.||.|....:..::|:|||||||.
plant     4 VPSCSSGNDTNNNDSSN-----------------------FECNICLDLAQDPIVTLCGHLFCWP 45

  Fly   108 CLWPKLSGTAQPR-CPCCQRHLLMYED-IMPFHGEGPNARQEDNNVPAQPG-SVP-RPTG 163
            ||:..|...:|.: ||.|:  .::.|| ::|.:|.|.::  .|....:.|| .|| ||:|
plant    46 CLYKWLHLHSQSKDCPVCK--AVIEEDRLVPLYGRGKSS--ADPRSKSIPGLEVPNRPSG 101

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8141NP_731776.1 zf-C3HC4_2 85..124 CDD:290634 17/39 (44%)
AT1G19310NP_564078.1 rad18 21..>112 CDD:273165 31/85 (36%)
RING-HC_AtRMA_like 21..65 CDD:319659 18/45 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5574
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000717
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12313
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
65.870

Return to query results.
Submit another query.