DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8141 and RMA3

DIOPT Version :9

Sequence 1:NP_731776.1 Gene:CG8141 / 41622 FlyBaseID:FBgn0038125 Length:239 Species:Drosophila melanogaster
Sequence 2:NP_194477.2 Gene:RMA3 / 828856 AraportID:AT4G27470 Length:243 Species:Arabidopsis thaliana


Alignment Length:212 Identity:44/212 - (20%)
Similarity:78/212 - (36%) Gaps:75/212 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    85 CNECNQYVRGGVITICGHLFCWTCLWP----KLSGTA----QPRCPCCQRHLLMYEDIMPFHGEG 141
            ||.|.......|:|:|||||||.|::.    :||..:    |..||.|:.::.: ..::|.:|.|
plant    44 CNICLDTAHDPVVTLCGHLFCWPCIYKWLHVQLSSVSVDQHQNNCPVCKSNITI-TSLVPLYGRG 107

  Fly   142 ---PNARQEDNNVPAQPGSVPRPTGLYLSDTDFPCWFAVNDPVDGCPATFPDIRRE--------- 194
               |::........|....:||.          |...|:.:|:....:..|.::.:         
plant   108 MSSPSSTFGSKKQDALSTDIPRR----------PAPSALRNPITSASSLNPSLQHQTLSPSFHNH 162

  Fly   195 ------------RDLHCAIRLIPMVYPWIG------------------AQ-------------IS 216
                        .||..|: ::..:||.||                  ||             ::
plant   163 QYSPRGFTTTESTDLANAV-MMSFLYPVIGMFGDLVYTRIFGTFTNTIAQPYQSQRMMQREKSLN 226

  Fly   217 FLKWFQLGCVLLIFLIW 233
            .:..|.|.|::|..|::
plant   227 RVSIFFLCCIILCLLLF 243

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8141NP_731776.1 zf-C3HC4_2 85..124 CDD:290634 18/46 (39%)
RMA3NP_194477.2 PLN03208 37..228 CDD:178747 39/195 (20%)
RING 43..95 CDD:238093 19/50 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5574
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000717
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12313
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
54.870

Return to query results.
Submit another query.