DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8141 and RNF5

DIOPT Version :9

Sequence 1:NP_731776.1 Gene:CG8141 / 41622 FlyBaseID:FBgn0038125 Length:239 Species:Drosophila melanogaster
Sequence 2:NP_008844.1 Gene:RNF5 / 6048 HGNCID:10068 Length:180 Species:Homo sapiens


Alignment Length:109 Identity:34/109 - (31%)
Similarity:49/109 - (44%) Gaps:12/109 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    57 QENDGEDDLLPGTRLRYRRRNLHLDPYVCNECNQYVRGGVITICGHLFCWTCL--WPKLSGTAQP 119
            :|.||      |.....|.|......:.||.|.:..|..|:::||||:||.||  |.:.....| 
Human     5 EEEDG------GPEGPNRERGGAGATFECNICLETAREAVVSVCGHLYCWPCLHQWLETRPERQ- 62

  Fly   120 RCPCCQRHLLMYEDIMPFHGEGPNARQEDN-NVPAQP-GSVPRP 161
            .||.|:.. :..|.::|.:|.|....|:.. ..|.:| |..|.|
Human    63 ECPVCKAG-ISREKVVPLYGRGSQKPQDPRLKTPPRPQGQRPAP 105

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8141NP_731776.1 zf-C3HC4_2 85..124 CDD:290634 17/40 (43%)
RNF5NP_008844.1 PLN03208 21..>116 CDD:178747 28/87 (32%)
RING-HC_RNF5 25..70 CDD:319657 18/45 (40%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 79..110 8/27 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5574
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S2074
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000717
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12313
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
65.820

Return to query results.
Submit another query.