DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8141 and rnf5

DIOPT Version :9

Sequence 1:NP_731776.1 Gene:CG8141 / 41622 FlyBaseID:FBgn0038125 Length:239 Species:Drosophila melanogaster
Sequence 2:NP_001017071.1 Gene:rnf5 / 549825 XenbaseID:XB-GENE-974969 Length:168 Species:Xenopus tropicalis


Alignment Length:140 Identity:41/140 - (29%)
Similarity:59/140 - (42%) Gaps:35/140 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    83 YVCNECNQYVRGGVITICGHLFCWTCL--WPKLSGTAQPRCPCCQRHLLMYEDIMPFHGEGPNAR 145
            |.||.|.:..|..|:::||||:||.||  |.:.....| .||.|:.. :..|.::|.:|.| ::.
 Frog    12 YECNICLETAREPVVSVCGHLYCWPCLHQWLETRPDRQ-ECPVCKAG-ISREKVIPIYGRG-DSN 73

  Fly   146 QEDNNVPAQP---GSVPRP-------------TGLYLS--DTDFPCWFAVNDPVDGCPATFPDIR 192
            |:|..:...|   |..|.|             ||.::|  ...||..|            |..:.
 Frog    74 QKDPRLKTPPRPQGQRPEPENRAGGGVPGFTDTGFHMSFGIGAFPFGF------------FTTVF 126

  Fly   193 RERDLHCAIR 202
            ...|||.|.|
 Frog   127 NTNDLHSAPR 136

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8141NP_731776.1 zf-C3HC4_2 85..124 CDD:290634 17/40 (43%)
rnf5NP_001017071.1 RING-HC_RNF5 12..57 CDD:319657 19/45 (42%)
RING-HC finger (C3HC4-type) 14..54 CDD:319657 17/40 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000717
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.