DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8141 and PEX10

DIOPT Version :9

Sequence 1:NP_731776.1 Gene:CG8141 / 41622 FlyBaseID:FBgn0038125 Length:239 Species:Drosophila melanogaster
Sequence 2:NP_722540.1 Gene:PEX10 / 5192 HGNCID:8851 Length:346 Species:Homo sapiens


Alignment Length:60 Identity:22/60 - (36%)
Similarity:30/60 - (50%) Gaps:8/60 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    71 LRYRRRNLH-----LDPYVCNECNQYVRGGVITICGHLFCWTCLWPKLSGTAQPRCPCCQ 125
            |.:||.:|.     .:| :|..|.:..|....|.|||||||.|:....|..|:  ||.|:
Human   275 LSHRRASLEERAVSRNP-LCTLCLEERRHPTATPCGHLFCWECITAWCSSKAE--CPLCR 331

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8141NP_731776.1 zf-C3HC4_2 85..124 CDD:290634 16/38 (42%)
PEX10NP_722540.1 Pex2_Pex12 18..263 CDD:282595
RING 293..334 CDD:238093 17/41 (41%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5574
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.