DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8141 and PEX10

DIOPT Version :10

Sequence 1:NP_731776.1 Gene:CG8141 / 41622 FlyBaseID:FBgn0038125 Length:239 Species:Drosophila melanogaster
Sequence 2:NP_722540.1 Gene:PEX10 / 5192 HGNCID:8851 Length:346 Species:Homo sapiens


Alignment Length:60 Identity:22/60 - (36%)
Similarity:30/60 - (50%) Gaps:8/60 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    71 LRYRRRNLH-----LDPYVCNECNQYVRGGVITICGHLFCWTCLWPKLSGTAQPRCPCCQ 125
            |.:||.:|.     .:| :|..|.:..|....|.|||||||.|:....|..|:  ||.|:
Human   275 LSHRRASLEERAVSRNP-LCTLCLEERRHPTATPCGHLFCWECITAWCSSKAE--CPLCR 331

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8141NP_731776.1 PLN03208 85..>155 CDD:178747 17/41 (41%)
PEX10NP_722540.1 Pex2_Pex12 18..263 CDD:398431
RING-HC_PEX10 293..342 CDD:438190 17/41 (41%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.