DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8141 and Rnf5

DIOPT Version :9

Sequence 1:NP_731776.1 Gene:CG8141 / 41622 FlyBaseID:FBgn0038125 Length:239 Species:Drosophila melanogaster
Sequence 2:NP_001102495.1 Gene:Rnf5 / 407784 RGDID:1588458 Length:180 Species:Rattus norvegicus


Alignment Length:109 Identity:34/109 - (31%)
Similarity:49/109 - (44%) Gaps:12/109 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    57 QENDGEDDLLPGTRLRYRRRNLHLDPYVCNECNQYVRGGVITICGHLFCWTCL--WPKLSGTAQP 119
            :|.||      |.....|.|......:.||.|.:..|..|:::||||:||.||  |.:.....| 
  Rat     5 EEEDG------GPEGPNRERGGASATFECNICLETAREAVVSVCGHLYCWPCLHQWLETRPDRQ- 62

  Fly   120 RCPCCQRHLLMYEDIMPFHGEGPNARQEDN-NVPAQP-GSVPRP 161
            .||.|:.. :..|.::|.:|.|....|:.. ..|.:| |..|.|
  Rat    63 ECPVCKAG-ISREKVVPLYGRGSQKPQDPRLKTPPRPQGQRPAP 105

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8141NP_731776.1 zf-C3HC4_2 85..124 CDD:290634 17/40 (43%)
Rnf5NP_001102495.1 PLN03208 25..>117 CDD:178747 28/83 (34%)
RING-HC_RNF5 25..70 CDD:319657 18/45 (40%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 79..110 8/27 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5574
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000717
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12313
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
54.870

Return to query results.
Submit another query.