DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8141 and rnf185

DIOPT Version :9

Sequence 1:NP_731776.1 Gene:CG8141 / 41622 FlyBaseID:FBgn0038125 Length:239 Species:Drosophila melanogaster
Sequence 2:NP_998202.1 Gene:rnf185 / 406310 ZFINID:ZDB-GENE-040426-1977 Length:194 Species:Danio rerio


Alignment Length:131 Identity:36/131 - (27%)
Similarity:51/131 - (38%) Gaps:28/131 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    83 YVCNECNQYVRGGVITICGHLFCWTCL--WPKLSGTAQPRCPCCQRHLLMYEDIMPFHGEGPNAR 145
            :.||.|....:..||::|||||||.||  |.:.....|. ||.|:.. :..:.::|.:|.|...:
Zfish    39 FECNICLDTSKDAVISLCGHLFCWPCLHQWLETRPNRQV-CPVCKAG-ISRDKVIPLYGRGSTGQ 101

  Fly   146 QE--DNNVPAQPGSVPRP------TGLYLSDTDFPCWFA--------------VND--PVDGCPA 186
            |:  :...|...|..|.|      .|....|..|...|.              :||  |....|.
Zfish   102 QDPREKTPPRPQGQRPEPENRGGFQGFGFGDGGFQMSFGIGAFPFGIFATAFNINDGRPPPAAPG 166

  Fly   187 T 187
            |
Zfish   167 T 167

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8141NP_731776.1 zf-C3HC4_2 85..124 CDD:290634 18/40 (45%)
rnf185NP_998202.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..32
Required for ubiquitin ligase activity and protection against ER stress-induced cell death. /evidence=ECO:0000250|UniProtKB:Q96GF1 31..82 18/43 (42%)
RING 40..85 CDD:238093 19/46 (41%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 92..126 8/33 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5574
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000717
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12313
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
54.870

Return to query results.
Submit another query.