powered by:
Protein Alignment CG8141 and Pex10
DIOPT Version :9
Sequence 1: | NP_731776.1 |
Gene: | CG8141 / 41622 |
FlyBaseID: | FBgn0038125 |
Length: | 239 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001261265.1 |
Gene: | Pex10 / 38182 |
FlyBaseID: | FBgn0035233 |
Length: | 299 |
Species: | Drosophila melanogaster |
Alignment Length: | 51 |
Identity: | 18/51 - (35%) |
Similarity: | 25/51 - (49%) |
Gaps: | 4/51 - (7%) |
- Green bases have known domain annotations that are detailed below.
Fly 80 LDPYV--CNECNQYVRGGVITICGHLFCWTCLWPKLSGTAQPRCPCCQRHL 128
:||.. |..|.:......:|.|||:|||:||...|. .:..||.|:..|
Fly 239 VDPNTPQCILCLEPRSDSSLTPCGHIFCWSCLLEWLE--ERDECPLCRESL 287
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG5574 |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
|
2 | 1.810 |
|
Return to query results.
Submit another query.