| Sequence 1: | NP_731776.1 | Gene: | CG8141 / 41622 | FlyBaseID: | FBgn0038125 | Length: | 239 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001261265.1 | Gene: | Pex10 / 38182 | FlyBaseID: | FBgn0035233 | Length: | 299 | Species: | Drosophila melanogaster |
| Alignment Length: | 51 | Identity: | 18/51 - (35%) |
|---|---|---|---|
| Similarity: | 25/51 - (49%) | Gaps: | 4/51 - (7%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 80 LDPYV--CNECNQYVRGGVITICGHLFCWTCLWPKLSGTAQPRCPCCQRHL 128 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CG8141 | NP_731776.1 | zf-C3HC4_2 | 85..124 | CDD:290634 | 14/38 (37%) |
| Pex10 | NP_001261265.1 | Pex2_Pex12 | 20..>173 | CDD:282595 | |
| zf-RING_2 | 244..284 | CDD:290367 | 14/41 (34%) | ||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 1 | 0.900 | - | - | E1_COG5574 | |
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| 2 | 1.810 | |||||