DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8141 and Rnf185

DIOPT Version :9

Sequence 1:NP_731776.1 Gene:CG8141 / 41622 FlyBaseID:FBgn0038125 Length:239 Species:Drosophila melanogaster
Sequence 2:NP_001019442.1 Gene:Rnf185 / 360967 RGDID:1564777 Length:192 Species:Rattus norvegicus


Alignment Length:223 Identity:54/223 - (24%)
Similarity:83/223 - (37%) Gaps:44/223 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 AENPSHGLQGEVISKGYIPDLSNANVNQQQQQENDGEDDLLPGTRLRYRRRNLHLDPYVCNECNQ 90
            ::.||.....|..|.|.....||..      .|:.|:|                 ..:.||.|..
  Rat     3 SKGPSASASTENSSAGGPSGSSNGT------GESGGQD-----------------STFECNICLD 44

  Fly    91 YVRGGVITICGHLFCWTCL--WPKLSGTAQPRCPCCQRHLLMYEDIMPFHGEGPNARQE--DNNV 151
            ..:..||::|||||||.||  |.:.....|. ||.|:.. :..:.::|.:|.|...:|:  :...
  Rat    45 TAKDAVISLCGHLFCWPCLHQWLETRPNRQV-CPVCKAG-ISRDKVIPLYGRGSTGQQDPREKTP 107

  Fly   152 PAQPGSVPRP------TGLYLSDTDFPCWFAVNDPVDGCPATFPDIRRERDLHCAIRLIPMVYPW 210
            |...|..|.|      .|....|..|...|.:.....|..||..:|...|....    :|....:
  Rat   108 PRPQGQRPEPENRGGFQGFGFGDGGFQMSFGIGAFPFGIFATAFNINDGRPPPA----VPGTPQY 168

  Fly   211 IGAQ-ISFLKWFQLGCVLLIFLIWSVLS 237
            :..| :|.|..|    |.|:.:.|.:::
  Rat   169 VDEQFLSRLFLF----VALVIMFWLLIA 192

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8141NP_731776.1 zf-C3HC4_2 85..124 CDD:290634 18/40 (45%)
Rnf185NP_001019442.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..30 7/32 (22%)
Required for ubiquitin ligase activity and protection against ER stress-induced cell death. /evidence=ECO:0000250|UniProtKB:Q96GF1 29..80 21/68 (31%)
RING-HC_RNF185 38..80 CDD:319658 18/42 (43%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 90..123 8/32 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5574
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000717
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12313
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
65.870

Return to query results.
Submit another query.