DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8141 and Rnf185

DIOPT Version :9

Sequence 1:NP_731776.1 Gene:CG8141 / 41622 FlyBaseID:FBgn0038125 Length:239 Species:Drosophila melanogaster
Sequence 2:NP_663330.2 Gene:Rnf185 / 193670 MGIID:1922078 Length:228 Species:Mus musculus


Alignment Length:222 Identity:54/222 - (24%)
Similarity:82/222 - (36%) Gaps:45/222 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 QGEVISKGYIPDLSNANVN-------QQQQQENDGEDDLLPGTRLRYRRRNLHLDPYVCNECNQY 91
            |..:.|||.....|..|.|       .....|:.|:|                 ..:.||.|...
Mouse    34 QAAMASKGPSASASTENSNAGGPSGSSNGTGESGGQD-----------------STFECNICLDT 81

  Fly    92 VRGGVITICGHLFCWTCL--WPKLSGTAQPRCPCCQRHLLMYEDIMPFHGEGPNARQE--DNNVP 152
            .:..||::|||||||.||  |.:.....|. ||.|:.. :..:.::|.:|.|...:|:  :...|
Mouse    82 AKDAVISLCGHLFCWPCLHQWLETRPNRQV-CPVCKAG-ISRDKVIPLYGRGSTGQQDPREKTPP 144

  Fly   153 AQPGSVPRP------TGLYLSDTDFPCWFAVNDPVDGCPATFPDIRRERDLHCAIRLIPMVYPWI 211
            ...|..|.|      .|....|..|...|.:.....|..||..:|...|....    :|....::
Mouse   145 RPQGQRPEPENRGGFQGFGFGDGGFQMSFGIGAFPFGIFATAFNINDGRPPPA----VPGTPQYV 205

  Fly   212 GAQ-ISFLKWFQLGCVLLIFLIWSVLS 237
            ..| :|.|..|    |.|:.:.|.:::
Mouse   206 DEQFLSRLFLF----VALVIMFWLLIA 228

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8141NP_731776.1 zf-C3HC4_2 85..124 CDD:290634 18/40 (45%)
Rnf185NP_663330.2 RING 74..119 CDD:238093 19/46 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5574
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000717
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12313
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
65.870

Return to query results.
Submit another query.