DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MCAM and CG17716

DIOPT Version :9

Sequence 1:NP_006491.2 Gene:MCAM / 4162 HGNCID:6934 Length:646 Species:Homo sapiens
Sequence 2:NP_001286391.1 Gene:CG17716 / 36521 FlyBaseID:FBgn0000633 Length:822 Species:Drosophila melanogaster


Alignment Length:543 Identity:123/543 - (22%)
Similarity:197/543 - (36%) Gaps:167/543 - (30%)


- Green bases have known domain annotations that are detailed below.


Human    19 PRVAGV------PGEAEQPAPELVEVEVGSTALLKCGLSQSQGNLSHVDWFS----VHKEKRTLI 73
            |||..:      |.|||:.:  :|..|..|...|.|.:..   :::...|:.    ||...||. 
  Fly   225 PRVLPLRPVPPNPYEAEEMS--VVYAEQHSEIKLMCEVDL---DIATSMWYKNGQVVHAMDRTA- 283

Human    74 FRVRQGQGQSEPGEYEQRLSLQDRGATLALTQVTPQDERIFLCQGKRPR--SQEYR-IQLRVYKA 135
             ||.           :.|...:..|| |.:|.|..:|:..:.|:.:..|  ::..| ::|.|...
  Fly   284 -RVT-----------DYRFIKEANGA-LTITNVMLEDDGKWQCEAENTRRYTENARPVKLVVLDR 335

Human   136 PEEP-------NIQVNPLGIPVNSKEPEEV-ATCVGRNGYPIPQVIWYKNGRPLKEEKNRVHIQS 192
            |:.|       .:..:.|.:||  ||..|: ..||...|.|.|.:.|              .:..
  Fly   336 PKPPYLLIDSRRLDASNLFVPV--KENSELNLACVSEGGNPRPTLTW--------------EVLL 384

Human   193 SQTVESSGLYTLQSILKAQLVKEDK-DAQFY-----CELNYRLPSGNHMKESREVTVPVFYPTEK 251
            |..|:.........:|:.:.:|.:| |...|     .:...|||:......:..:...:.:||.|
  Fly   385 SPGVDRHAQKVSAEVLELEEIKGEKLDKDGYKINSGAKSEARLPAVYRAHHNARILCVMEHPTLK 449

Human   252 V------WLEVE---------------PVGMLKEGDRVEIRCLADGNPPPHFSISKQNPSTREAE 295
            :      .|:|:               |   |:||..|.::|..|.|||       ..|..::.:
  Fly   450 IRQNASLLLDVQYTPSFAISRTPGFGYP---LREGIEVSLKCDVDSNPP-------STPRWQKDD 504

Human   296 EET----TNDNGVLVLEPARKEHSGRYECQGLDLD--------------TMISLLSEPQELLVNY 342
            .:|    |.| |.|.....|:||||.|:|....|:              ..:.:.|||.:     
  Fly   505 GDTPVPQTGD-GFLNFTSIRREHSGWYKCTSRHLNFQYSSIGYYLSVRFDSVDVTSEPDD----- 563

Human   343 VSDVRVSPAAP-------ERQEGSSLTLTCE-----AESSQDLEFQWLR-------EETGQVLER 388
             .||.|:.|:.       |.|.|.::||.|.     ..|..|.....||       :.|||    
  Fly   564 -QDVSVAAASHNPNKGQLEVQLGGAVTLQCPQGSLGCWSHLDPISARLRGLGYGSSQPTGQ---- 623

Human   389 GPVLQLHDLKREAGGGYRCVASVPSIPGLNRTQL-----VNVAIFGPPWMAFKERKVWVKENMVL 448
               ..|.|:..:..|.|:||...|:    |:.:|     |.|::.|.|              .|:
  Fly   624 ---FSLKDVMYQDAGMYKCVGQSPT----NKKKLEVLQSVTVSVKGAP--------------TVM 667

Human   449 NLSCEASGHPRPTISWNVNGTAS 471
            .|:.....:|...:..||...|:
  Fly   668 ALNATPVAYPGSPLHLNVEFCAN 690

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MCAMNP_006491.2 Ig 33..117 CDD:325142 19/87 (22%)
C2-set_2 139..234 CDD:311910 23/108 (21%)
Ig_3 261..321 CDD:316449 21/63 (33%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 278..299 4/24 (17%)
Ig_3 346..410 CDD:316449 22/82 (27%)
Ig 450..510 CDD:325142 5/22 (23%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 525..554
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 620..646
CG17716NP_001286391.1 IG_like 244..332 CDD:214653 23/106 (22%)
Ig 254..323 CDD:143165 18/85 (21%)
Ig 359..452 CDD:299845 21/106 (20%)
Ig_3 477..536 CDD:290638 23/69 (33%)
IG_like 479..550 CDD:214653 22/78 (28%)
IG_like 578..660 CDD:214653 24/92 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.