DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment 2mit and PODNL1

DIOPT Version :9

Sequence 1:NP_001262529.1 Gene:2mit / 41616 FlyBaseID:FBgn0260793 Length:1155 Species:Drosophila melanogaster
Sequence 2:XP_011526610.1 Gene:PODNL1 / 79883 HGNCID:26275 Length:579 Species:Homo sapiens


Alignment Length:546 Identity:157/546 - (28%)
Similarity:225/546 - (41%) Gaps:124/546 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 CDLGLALLLAWTWLTRLVVAAHLVDIPTSSRLAAEREEQQLSRQDVGRLS---YQSIH-RMLRDE 69
            || ||.|.:....:||  .|.||        .....:.|:|...::.|||   ..::| .::..|
Human    58 CD-GLDLRVFPDNITR--AAQHL--------SLQNNQLQELPYNELSRLSGLRTLNLHNNLISSE 111

  Fly    70 NEPDSFRGELRYQQKRHKRELELNAPANKLNLT----HRDLRTFNSTGGQWKGDFQVITAMDLSS 130
            ..||.....|  .|.:|     |....|||::.    .|.||                 ..||::
Human   112 GLPDEAFESL--TQLQH-----LCVAHNKLSVAPQFLPRSLR-----------------VADLAA 152

  Fly   131 NQLESLSLDNFNQ---LRQLDLGNNSLEVIPLSLADTNMSLP---------FVTLDLSCNKFSQI 183
            ||:..:....|.:   ||.:.|.||.|         :|..||         ..||.||.|:.|.:
Human   153 NQVMEIFPLTFGEKPALRSVYLHNNQL---------SNAGLPPDAFRGSEAIATLSLSNNQLSYL 208

  Fly   184 STSFFAQRLPQLKNLNLAHNELLNISRESFYNLLELQTLVLSHNNISD--IDYETFLALPNLQYL 246
            ..|.    .|.|:.|:|.:|.:..:.|.:.....:|:.|.|.||.::|  :|..||..|.:|:||
Human   209 PPSL----PPSLERLHLQNNLISKVPRGALSRQTQLRELYLQHNQLTDSGLDATTFSKLHSLEYL 269

  Fly   247 DLSHNRLS----------------GSAIR-----ALQGIPDLVSLSIAYNP--DVGVAMQEFVAS 288
            |||||:|:                .:.||     .|.|...|..|.:.:|.  ..|:........
Human   270 DLSHNQLTTVPAGLPRTLAILHLGRNRIRQVEAARLHGARGLRYLLLQHNQLGSSGLPAGALRPL 334

  Fly   289 WSLKELDASGTGLCQVPAALAQSVRTLKLSDNWLKAINCGDMDSYPLLQYLDLSHSRI--AQVED 351
            ..|..|...|.||.:||.||.:.:|.|.|..|.:.|:...|:.:.|.|..|:|:::|:  |:|..
Human   335 RGLHTLHLYGNGLDRVPPALPRRLRALVLPHNHVAALGARDLVATPGLTELNLAYNRLASARVHH 399

  Fly   352 DALGRLELLESLFLDRNLLMRVPSSLPPSLEHLFLQHNQIMELPPQAFVGLVN------------ 404
            .|..||..|.||.|..|.|.|:|..||..|..|.||.||:..|.|:...||..            
Human   400 RAFRRLRALRSLDLAGNQLTRLPMGLPTGLRTLQLQRNQLRMLEPEPLAGLDQLRELSLAHNRLR 464

  Fly   405 --------------LQTLDLSNNRLIFLPPLSLPKLL-TLNLESSGVESVSQSIVHTLPQLRDLL 454
                          ||.||||:|.|.|:|| .||:.| .|:||.:.:..|......:.|:||.|.
Human   465 VGDIGPGTWHELQALQMLDLSHNELSFVPP-DLPEALEELHLEGNRIGHVGPEAFLSTPRLRALF 528

  Fly   455 LEDNPIKCSDLLGIAEWASP-CRSVD 479
            |..|.:..:.:...|....| .|.||
Human   529 LRANRLHMTSIAAEAFLGLPNLRVVD 554

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
2mitNP_001262529.1 LRR_RI 124..355 CDD:238064 77/269 (29%)
leucine-rich repeat 124..143 CDD:275380 5/18 (28%)
leucine-rich repeat 144..167 CDD:275380 7/22 (32%)
leucine-rich repeat 172..194 CDD:275380 7/21 (33%)
LRR_8 193..253 CDD:290566 24/61 (39%)
leucine-rich repeat 195..218 CDD:275380 5/22 (23%)
leucine-rich repeat 219..242 CDD:275380 10/24 (42%)
LRR_8 241..301 CDD:290566 20/82 (24%)
leucine-rich repeat 243..311 CDD:275380 26/90 (29%)
leucine-rich repeat 312..335 CDD:275380 6/22 (27%)
LRR_8 334..415 CDD:290566 37/108 (34%)
leucine-rich repeat 336..359 CDD:275380 9/24 (38%)
leucine-rich repeat 360..380 CDD:275380 10/19 (53%)
LRR_8 379..460 CDD:290566 34/107 (32%)
LRR_4 379..>415 CDD:289563 17/61 (28%)
leucine-rich repeat 381..404 CDD:275380 10/22 (45%)
leucine-rich repeat 405..449 CDD:275380 18/44 (41%)
PODNL1XP_011526610.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm40317
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.