DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment 2mit and trn

DIOPT Version :9

Sequence 1:NP_001262529.1 Gene:2mit / 41616 FlyBaseID:FBgn0260793 Length:1155 Species:Drosophila melanogaster
Sequence 2:NP_001261796.1 Gene:trn / 39491 FlyBaseID:FBgn0010452 Length:751 Species:Drosophila melanogaster


Alignment Length:476 Identity:115/476 - (24%)
Similarity:191/476 - (40%) Gaps:83/476 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 LALLLAWTWLTRLVV--AAHLVDIP-----TSSRLAAEREEQQLSRQDVGRLSYQ-SIHRMLRDE 69
            :|.:..|..|..:.|  ||.|.:.|     ..:.|..:..|.||   ||..::.. ||.|::...
  Fly     7 IAFVGIWCILASIGVEPAAGLANCPPGCQCDDNTLVVQCGEGQL---DVLPIALNPSIQRLVIKS 68

  Fly    70 NEPDSFRGELRYQQKRHKRELELN----------APANKLNLTHRDLRTFNSTGGQWKGDFQVIT 124
            |:..:....:::..:....:|..|          |...||...|.:.........:.......:|
  Fly    69 NKIKTIDSSIQFYAELTFLDLSSNHLMTIPQRTFAYQKKLQEVHLNHNKIGQISNKTFIGLSAVT 133

  Fly   125 AMDLSSNQLESLSLDNFN---QLRQLDLGNNSLEVIPLSLADTNMSLPFVTLDLSCNKFSQISTS 186
            .::|..||:..|....|.   ::.:|:||.|.:..:.....|....|..:.||  .|..:.:...
  Fly   134 VLNLRGNQISELHQGTFTPLLKIEELNLGENRIGYLDPKAFDGLSQLRILYLD--DNALTTVPDP 196

  Fly   187 FFAQRLPQLKNLNLAHNELLNISRESFYNLLELQTLVLSHNNISDIDYETFLALPNLQYLDLSHN 251
            ...|.:|.|..|.|..|.|.:|..::|.:|..|..|.|...::.:|.:::||.|..|:.||||.|
  Fly   197 VIFQAMPSLAELFLGMNTLQSIQADAFQDLKGLTRLELKGASLRNISHDSFLGLQELRILDLSDN 261

  Fly   252 RLSGSAIRALQGIPDLVSLSIAYNPDVGVAMQEFVASWSLKELDASGTGLCQVPAALAQSVRTLK 316
            ||.......|..:..|..||:..|....::...|:....||.|:.:|       |...:.|.|..
  Fly   262 RLDRIPSVGLSKLVRLEQLSLGQNDFEVISEGAFMGLKQLKRLEVNG-------ALRLKRVMTGA 319

  Fly   317 LSDNWLKAINCGDMDSYPLLQYLDLSHSR-IAQVEDDALGRLELLESLFLDRNLLMRVPSSLPPS 380
            .|||       |:      |:||:||.:: :.:|::.||..|..|:.:.|..|.|..:...|.| 
  Fly   320 FSDN-------GN------LEYLNLSSNKMLLEVQEGALSGLSQLKHVVLKANALTSLAEGLFP- 370

  Fly   381 LEHLFLQHNQIMELPPQAFVGLVNLQTLDLSNN------RLIFLPPLSLPKLLTLNLESSGVESV 439
                                 ..:|||||||.|      |:::|..|.:.|       ::..:.|
  Fly   371 ---------------------WKDLQTLDLSENPLSCDCRVMWLHNLLVAK-------NASQDDV 407

  Fly   440 SQSIVHTLPQLR-DLLLEDNP 459
            |:.:.....:|| :.|...||
  Fly   408 SELLCEFPERLRGESLRHLNP 428

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
2mitNP_001262529.1 LRR_RI 124..355 CDD:238064 64/234 (27%)
leucine-rich repeat 124..143 CDD:275380 6/21 (29%)
leucine-rich repeat 144..167 CDD:275380 5/22 (23%)
leucine-rich repeat 172..194 CDD:275380 4/21 (19%)
LRR_8 193..253 CDD:290566 22/59 (37%)
leucine-rich repeat 195..218 CDD:275380 8/22 (36%)
leucine-rich repeat 219..242 CDD:275380 7/22 (32%)
LRR_8 241..301 CDD:290566 18/59 (31%)
leucine-rich repeat 243..311 CDD:275380 19/67 (28%)
leucine-rich repeat 312..335 CDD:275380 6/22 (27%)
LRR_8 334..415 CDD:290566 23/87 (26%)
leucine-rich repeat 336..359 CDD:275380 9/23 (39%)
leucine-rich repeat 360..380 CDD:275380 5/19 (26%)
LRR_8 379..460 CDD:290566 20/88 (23%)
LRR_4 379..>415 CDD:289563 9/41 (22%)
leucine-rich repeat 381..404 CDD:275380 0/22 (0%)
leucine-rich repeat 405..449 CDD:275380 14/49 (29%)
trnNP_001261796.1 leucine-rich repeat 62..80 CDD:275380 2/17 (12%)
LRR_8 83..142 CDD:290566 9/58 (16%)
leucine-rich repeat 84..107 CDD:275380 3/22 (14%)
leucine-rich repeat 108..131 CDD:275380 2/22 (9%)
LRR_RI 129..421 CDD:238064 88/342 (26%)
LRR_8 132..190 CDD:290566 15/59 (25%)
leucine-rich repeat 132..155 CDD:275380 6/22 (27%)
leucine-rich repeat 156..179 CDD:275380 5/22 (23%)
leucine-rich repeat 180..204 CDD:275380 5/25 (20%)
LRR_8 203..263 CDD:290566 22/59 (37%)
leucine-rich repeat 205..228 CDD:275380 8/22 (36%)
leucine-rich repeat 229..252 CDD:275380 7/22 (32%)
LRR_8 252..308 CDD:290566 17/55 (31%)
leucine-rich repeat 253..276 CDD:275380 9/22 (41%)
leucine-rich repeat 277..300 CDD:275380 5/22 (23%)
leucine-rich repeat 301..322 CDD:275380 7/27 (26%)
LRR_8 325..384 CDD:290566 23/86 (27%)
leucine-rich repeat 326..350 CDD:275380 9/23 (39%)
leucine-rich repeat 351..373 CDD:275380 6/43 (14%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45472911
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.