DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment 2mit and CG6749

DIOPT Version :9

Sequence 1:NP_001262529.1 Gene:2mit / 41616 FlyBaseID:FBgn0260793 Length:1155 Species:Drosophila melanogaster
Sequence 2:NP_648354.1 Gene:CG6749 / 39144 FlyBaseID:FBgn0036040 Length:552 Species:Drosophila melanogaster


Alignment Length:457 Identity:126/457 - (27%)
Similarity:180/457 - (39%) Gaps:132/457 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 SRQDVGRLSYQSIH----RMLRDENEPDSFRGELRYQQKRHKRELELN--APANKLNLTHR---- 104
            |.||:..|..::.|    |.::.|.|..|  || ......:..:|:|.  ||.|    .|.    
  Fly    44 SLQDLVDLGAENWHTLAIRNVQTELEVGS--GE-NADHLANLLDLDLTGAAPIN----VHTNGFS 101

  Fly   105 ---DLRTFNSTG-------GQWKGDFQVITAMDLSSNQLESLSLDNFNQLRQL---DLGNNSLEV 156
               :||..|.:|       |........:..:|.|.||:|.|..|.|..||:|   :..:|:|: 
  Fly   102 ILPNLRQLNLSGCGLVDIRGNHFAPESALQRIDFSHNQMELLDRDFFGNLRKLIYANFSHNALK- 165

  Fly   157 IPLSLADTNMSLPFVTLDLSCNKFSQISTSFFAQRLPQLKNLNLAHNELLNISRESFYNLLELQT 221
                    ...||                     .:|.|..|.|.||.|:|   .:|....:||.
  Fly   166 --------QCDLP---------------------HMPLLNRLELGHNRLVN---ATFGVCPQLQE 198

  Fly   222 LVLSHNNISDIDYETFLALPNLQYLDLSHNRLSGSAIRALQGIPDLVSLSIAYN------PDVGV 280
            |:|:.|.:..:|...|..|..|..|.||.||||...:...|.:..|..|:::.|      |:|..
  Fly   199 LILNDNQLIQLDVNAFRGLHGLLELQLSGNRLSSIGLETFQPLAQLRKLNLSQNALDALRPNVFG 263

  Fly   281 AMQEFVASWSLKELDASGTGLCQVPAALAQSVRTLKLSDNWLKAINCGDMDSYPLLQYLDLSHSR 345
            |:|.||.  .|::||.||.             |...|.||..:.:        ..||.||:|.:.
  Fly   264 AVQNFVL--HLQQLDLSGN-------------RIRLLFDNQFRVL--------ARLQMLDVSRNS 305

  Fly   346 IAQVEDDALGRLELLESLFLDRNLLMRVPSSLPP-------SLEHLFLQHNQIMELPPQAFVGLV 403
            ||                            ||.|       ||..|:||:|.|:|:.|..|..|:
  Fly   306 IA----------------------------SLSPAHFVGLGSLRKLYLQYNAILEIKPATFAALL 342

  Fly   404 NLQTLDLSNNRLIFLPPL-----SLPKLLTLNLESSGVESVSQSIVHTLPQLRDLLLEDNPIKCS 463
            ||.|||||.|.|.||...     :||::..|||..:.::.:......:||.|..|.|..|.:|..
  Fly   343 NLDTLDLSYNNLEFLEEQIFGGNTLPRMRRLNLNGNRMKHLHPLAFSSLPFLEYLKLGHNELKSL 407

  Fly   464 DL 465
            |:
  Fly   408 DV 409

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
2mitNP_001262529.1 LRR_RI 124..355 CDD:238064 66/239 (28%)
leucine-rich repeat 124..143 CDD:275380 8/18 (44%)
leucine-rich repeat 144..167 CDD:275380 5/25 (20%)
leucine-rich repeat 172..194 CDD:275380 0/21 (0%)
LRR_8 193..253 CDD:290566 22/59 (37%)
leucine-rich repeat 195..218 CDD:275380 8/22 (36%)
leucine-rich repeat 219..242 CDD:275380 8/22 (36%)
LRR_8 241..301 CDD:290566 23/65 (35%)
leucine-rich repeat 243..311 CDD:275380 23/73 (32%)
leucine-rich repeat 312..335 CDD:275380 4/22 (18%)
LRR_8 334..415 CDD:290566 29/87 (33%)
leucine-rich repeat 336..359 CDD:275380 7/22 (32%)
leucine-rich repeat 360..380 CDD:275380 3/26 (12%)
LRR_8 379..460 CDD:290566 34/92 (37%)
LRR_4 379..>415 CDD:289563 20/42 (48%)
leucine-rich repeat 381..404 CDD:275380 10/22 (45%)
leucine-rich repeat 405..449 CDD:275380 16/48 (33%)
CG6749NP_648354.1 LRR_RI 103..>256 CDD:238064 49/185 (26%)
LRR_8 104..164 CDD:290566 17/59 (29%)
leucine-rich repeat 106..129 CDD:275380 5/22 (23%)
leucine-rich repeat 130..153 CDD:275380 9/22 (41%)
leucine-rich repeat 154..195 CDD:275380 14/73 (19%)
LRR_RI 194..455 CDD:238064 80/267 (30%)
LRR_8 194..254 CDD:290566 20/59 (34%)
leucine-rich repeat 196..219 CDD:275380 8/22 (36%)
leucine-rich repeat 220..243 CDD:275380 9/22 (41%)
leucine-rich repeat 244..267 CDD:275380 6/22 (27%)
LRR_8 271..330 CDD:290566 25/107 (23%)
leucine-rich repeat 272..295 CDD:275380 9/43 (21%)
leucine-rich repeat 296..319 CDD:275380 10/50 (20%)
LRR_8 319..380 CDD:290566 27/60 (45%)
leucine-rich repeat 320..343 CDD:275380 10/22 (45%)
leucine-rich repeat 344..369 CDD:275380 11/24 (46%)
LRR_8 368..428 CDD:290566 12/42 (29%)
leucine-rich repeat 370..393 CDD:275380 4/22 (18%)
leucine-rich repeat 394..417 CDD:275380 6/16 (38%)
leucine-rich repeat 418..441 CDD:275380
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45472904
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR45617
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.