DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment 2mit and CG4781

DIOPT Version :9

Sequence 1:NP_001262529.1 Gene:2mit / 41616 FlyBaseID:FBgn0260793 Length:1155 Species:Drosophila melanogaster
Sequence 2:NP_611951.1 Gene:CG4781 / 37943 FlyBaseID:FBgn0035043 Length:469 Species:Drosophila melanogaster


Alignment Length:371 Identity:91/371 - (24%)
Similarity:141/371 - (38%) Gaps:122/371 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   150 GNNSLEV----IPLSLADTNMSLPFV--TLDLSCNKFSQISTSFFAQRLPQLKNLNLAHNELLNI 208
            ||.:|.:    ....:||.::.||..  :||||.|....:.. |.:..|.|   |||.||.:..:
  Fly    62 GNRALRIDCSYKDYKVADLSLLLPLYIDSLDLSWNALDSVPI-FTSDSLHQ---LNLRHNNISQL 122

  Fly   209 SRESFYNLLELQTLVLSHNNISDIDYETFLALPNLQYLDLSHNRLSGSAIRALQG---IPDLV-- 268
            ...:|..|..|:.|.|..|:|..::..:|..||:||.|||:||.|     ..|.|   .|.||  
  Fly   123 VSGNFKQLTSLRELYLGWNSIGKLESGSFDGLPHLQVLDLAHNNL-----HLLPGHLFAPLLVLG 182

  Fly   269 SLSIAYNPDVGVAMQEFVASWSLKELDASG----TGLCQVPAALAQSVRTLKLSDNWLKAINCGD 329
            :|.|::|                :..:.||    ||                |..||        
  Fly   183 TLDISWN----------------RRFNESGGDLYTG----------------LGVNW-------- 207

  Fly   330 MDSYPLLQYLDLSHSRIAQVEDDA--LGRLEL-----LESLFLDRNLLMRVPSSLPPSLEHLFLQ 387
                           :::.:..||  |..|.|     |:.|.|.||.|.|:|:.||.:|..|.:.
  Fly   208 ---------------KLSTLRLDACSLNDLHLPVNAPLKELSLRRNQLKRIPTQLPETLLRLDIS 257

  Fly   388 HNQIMELPPQAFVGLVN-------------------------LQTLDLSNNRLI-------FLPP 420
            .|.:.||.|:....|..                         |:||...|:|.:       |.|.
  Fly   258 DNLLEELLPEDTANLTQVRQLFIEDMPVLQRVVANSLTHVDVLETLSFQNSRQLSHLDAEAFGPI 322

  Fly   421 LSLP----KLLTLNLESSGVESVSQSIVHTLPQLRDLLLEDNPIKC 462
            ::.|    .|.:|:...:.:.:.:.::.....||.:|.|...|::|
  Fly   323 MTTPTKKRALRSLSFRGTMLRTFNSTLAPIFTQLAELDLNGLPLQC 368

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
2mitNP_001262529.1 LRR_RI 124..355 CDD:238064 55/221 (25%)
leucine-rich repeat 124..143 CDD:275380
leucine-rich repeat 144..167 CDD:275380 5/20 (25%)
leucine-rich repeat 172..194 CDD:275380 7/21 (33%)
LRR_8 193..253 CDD:290566 23/59 (39%)
leucine-rich repeat 195..218 CDD:275380 7/22 (32%)
leucine-rich repeat 219..242 CDD:275380 7/22 (32%)
LRR_8 241..301 CDD:290566 20/68 (29%)
leucine-rich repeat 243..311 CDD:275380 20/76 (26%)
leucine-rich repeat 312..335 CDD:275380 3/22 (14%)
LRR_8 334..415 CDD:290566 26/112 (23%)
leucine-rich repeat 336..359 CDD:275380 4/24 (17%)
leucine-rich repeat 360..380 CDD:275380 10/19 (53%)
LRR_8 379..460 CDD:290566 21/116 (18%)
LRR_4 379..>415 CDD:289563 11/60 (18%)
leucine-rich repeat 381..404 CDD:275380 7/22 (32%)
leucine-rich repeat 405..449 CDD:275380 10/54 (19%)
CG4781NP_611951.1 leucine-rich repeat 90..108 CDD:275380 6/18 (33%)
LRR_8 108..167 CDD:290566 24/61 (39%)
leucine-rich repeat 109..132 CDD:275380 9/25 (36%)
LRR_RI <121..>261 CDD:238064 51/199 (26%)
leucine-rich repeat 133..156 CDD:275380 7/22 (32%)
leucine-rich repeat 157..180 CDD:275380 11/27 (41%)
leucine-rich repeat 181..208 CDD:275380 10/81 (12%)
leucine-rich repeat 230..253 CDD:275380 11/22 (50%)
leucine-rich repeat 254..274 CDD:275380 6/19 (32%)
leucine-rich repeat 275..299 CDD:275380 0/23 (0%)
leucine-rich repeat 300..319 CDD:275380 5/18 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR45617
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.