DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment 2mit and CG5096

DIOPT Version :9

Sequence 1:NP_001262529.1 Gene:2mit / 41616 FlyBaseID:FBgn0260793 Length:1155 Species:Drosophila melanogaster
Sequence 2:NP_723576.1 Gene:CG5096 / 34410 FlyBaseID:FBgn0032235 Length:491 Species:Drosophila melanogaster


Alignment Length:340 Identity:88/340 - (25%)
Similarity:151/340 - (44%) Gaps:72/340 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   126 MDLSSNQLESLSLDNFNQL-------RQLDLGNNSLEVIPLSLADTNMSLP---FVTLDLSCNKF 180
            :|.|....:.||.:::..|       :.::|.:|:|..:|:        ||   ...|.|:.|:.
  Fly    59 LDCSEKLQDWLSAEDWEDLTNGNVVFKTINLEHNNLTSVPI--------LPKYDVENLYLANNQI 115

  Fly   181 SQISTSFFAQRLPQLKNLNLAHNELLN-----------ISRESFYNLLELQTLVLSHNNISDIDY 234
            ..||...| |.|.:|..|:|:||.|.:           .:.:.|.:|..|:||.|.:|::..:|.
  Fly   116 DSISVGAF-QNLTELVTLDLSHNRLTSKVLVPDVFKGPFTVQDFESLENLKTLNLGYNDLHSLDA 179

  Fly   235 ETFLALPNLQYLDLSHN------RLSGSAIRALQG--IPDLVSLSIAYNPDVGV----AMQEFVA 287
            :.|..:|:::.|.|..|      :||.:||..||.  |.|:..:.|...||..:    .::.|:|
  Fly   180 DLFEHIPHIEELVLCSNSFHVIDQLSETAISGLQSLKILDVSYMEIDDLPDTILHGPRDLEIFIA 244

  Fly   288 SWSLKELDASGTGLCQVPAAL--AQSVRTLKLSDNWLKAINCGDMDSYPLLQYLDLS---HSRIA 347
            :.:|         ..|:|.||  |.::.:|.|::|.::.: .||....||.:...||   .|::.
  Fly   245 AGNL---------FNQLPKALKYATNLTSLVLNENPIENL-IGDNVFPPLTKLTHLSMTFMSKLY 299

  Fly   348 QVEDDALGRLELLESLFL-DRNLLMRVPS-------------SLPPSLEHLFLQHNQIMELPPQA 398
            ::...|...|:.|..|.| |..||..:..             ..|| ||.::|.:..:..||.:.
  Fly   300 KIGPGAFSELQSLTELILSDNKLLNEIDEEALSKNVTGGQYLDYPP-LEKVYLNNCNVSTLPKEL 363

  Fly   399 FVGLVNLQTLDLSNN 413
            .|....|:.|||..|
  Fly   364 LVRWDKLKALDLRFN 378

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
2mitNP_001262529.1 LRR_RI 124..355 CDD:238064 68/266 (26%)
leucine-rich repeat 124..143 CDD:275380 4/16 (25%)
leucine-rich repeat 144..167 CDD:275380 5/29 (17%)
leucine-rich repeat 172..194 CDD:275380 8/21 (38%)
LRR_8 193..253 CDD:290566 19/76 (25%)
leucine-rich repeat 195..218 CDD:275380 8/33 (24%)
leucine-rich repeat 219..242 CDD:275380 7/22 (32%)
LRR_8 241..301 CDD:290566 18/71 (25%)
leucine-rich repeat 243..311 CDD:275380 22/81 (27%)
leucine-rich repeat 312..335 CDD:275380 5/22 (23%)
LRR_8 334..415 CDD:290566 26/97 (27%)
leucine-rich repeat 336..359 CDD:275380 5/25 (20%)
leucine-rich repeat 360..380 CDD:275380 7/33 (21%)
LRR_8 379..460 CDD:290566 12/35 (34%)
LRR_4 379..>415 CDD:289563 12/35 (34%)
leucine-rich repeat 381..404 CDD:275380 6/22 (27%)
leucine-rich repeat 405..449 CDD:275380 5/9 (56%)
CG5096NP_723576.1 LRR_RI 69..378 CDD:238064 85/328 (26%)
leucine-rich repeat 85..104 CDD:275380 6/26 (23%)
LRR_8 105..174 CDD:290566 21/69 (30%)
leucine-rich repeat 105..128 CDD:275380 8/23 (35%)
leucine-rich repeat 129..163 CDD:275380 8/33 (24%)
LRR_8 163..222 CDD:290566 19/58 (33%)
leucine-rich repeat 164..187 CDD:275380 7/22 (32%)
leucine-rich repeat 188..214 CDD:275380 8/25 (32%)
leucine-rich repeat 215..238 CDD:275380 5/22 (23%)
leucine-rich repeat 239..261 CDD:275380 8/30 (27%)
LRR_8 260..322 CDD:290566 16/62 (26%)
leucine-rich repeat 262..286 CDD:275380 7/24 (29%)
leucine-rich repeat 287..311 CDD:275380 5/23 (22%)
leucine-rich repeat 346..369 CDD:275380 6/22 (27%)
leucine-rich repeat 370..388 CDD:275380 5/9 (56%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR45617
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.