DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment 2mit and Toll-4

DIOPT Version :9

Sequence 1:NP_001262529.1 Gene:2mit / 41616 FlyBaseID:FBgn0260793 Length:1155 Species:Drosophila melanogaster
Sequence 2:NP_523519.2 Gene:Toll-4 / 34235 FlyBaseID:FBgn0032095 Length:1125 Species:Drosophila melanogaster


Alignment Length:589 Identity:122/589 - (20%)
Similarity:185/589 - (31%) Gaps:251/589 - (42%)


- Green bases have known domain annotations that are detailed below.


  Fly    85 RHKRELELNAPANKLNLTHRDLRTFNSTGGQWKGDFQVITAMDLSSNQLESL---SLDNFNQLRQ 146
            |.|.:||::.       ..::|.|..|.....||.    :|:...||.|..|   ||:.::.|:.
  Fly   382 RDKSQLEIDC-------WQKNLTTIPSLPVPKKGS----SALVFQSNLLAELPDNSLEGYHNLKS 435

  Fly   147 LDLGNN-----SLEVIPLSL--------ADTNMSLPFVTLDLSCNKFSQ---------------- 182
            ||:..|     |:..:|.||        ..|.:|...|....|.|.|:|                
  Fly   436 LDVSYNQLTSLSVSQLPESLHYLDIRHNKITTLSPQVVEYLYSVNVFNQYGNKWSIYCDEYHLQE 500

  Fly   183 ----------ISTS--------------------FFAQRLPQL-----------------KNLNL 200
                      |.||                    ||.|.:.||                 |..||
  Fly   501 FFWYKAKLLRIKTSKFQTIMEYIELSSKGSFVENFFVQNIDQLYLEANEDEIIDAFGPSDKYFNL 565

  Fly   201 AHNELLNISRESFYNLLELQTLVLSH------------------------NNIS---------DI 232
            ...|.||.:...|..  |...::|.|                        .|:|         .|
  Fly   566 KLMEALNHAIWLFSG--EFDEIILHHLNSPCPYRCSCCFEWHTGEFLINCRNLSLDIYPRLPNSI 628

  Fly   233 DYETFLAL-----------------------------------------PNLQYLDLSHN---RL 253
            .|:|.|.|                                         .|:.|||:.:|   .|
  Fly   629 PYKTTLYLDRNEIRKLTNTESLVVAGHASIHKLHMSQNLLRELPLHLLPENITYLDVRNNLLKYL 693

  Fly   254 SGSAIRALQGIPDLVSLSIAYNPDVGVAMQEFVASWSLKELDASGTGLCQVPAALA--------- 309
            ....|..|:...::..:.::.||            |...         |:..|.|:         
  Fly   694 DDGVIAFLEYRENITKIELSGNP------------WECN---------CKAKAFLSFLRRHEPME 737

  Fly   310 --QSVRTLKLSDNWL--KAINCGDMDSYPLLQY-LDLSH---SRIAQVEDDALGRLELLESLFLD 366
              ..:|.::::|:..  ..|.|.|..:...|.| :|.|.   |.|.|:.....|:    .:|..:
  Fly   738 YETVLRRVEITDDKCPEDCICCVDTSNSDSLAYVVDCSGKELSEIPQLPTPTYGQ----TTLVFE 798

  Fly   367 RNLLMRVPSSLPP---SLEHLFLQHNQ---IMELPPQAFVGLVNLQTLDLSNNRLIFLPPLSLPK 425
            ||.|.:.||||.|   |:...:|.||:   |.:||.:       |:.||:|||....|.. .:..
  Fly   799 RNSLKKWPSSLLPGYSSVTRFYLAHNRLSDIDQLPDK-------LEYLDISNNNFSALDD-RVRG 855

  Fly   426 LLTLNLESSGVESVSQSIVHTLPQLRDLLLEDNP--IKCSD---LLGIAEW------ASPCRSVD 479
            .|...:.||.::               |.|..||  .:|.|   |:.:.|.      ||..:.:|
  Fly   856 FLQKRMNSSQLQ---------------LSLFGNPWTCRCEDKDFLVFVKEQAKNIANASAIQCID 905

  Fly   480 AGQS 483
            .|:|
  Fly   906 TGRS 909

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
2mitNP_001262529.1 LRR_RI 124..355 CDD:238064 73/403 (18%)
leucine-rich repeat 124..143 CDD:275380 7/21 (33%)
leucine-rich repeat 144..167 CDD:275380 9/35 (26%)
leucine-rich repeat 172..194 CDD:275380 10/67 (15%)
LRR_8 193..253 CDD:290566 24/153 (16%)
leucine-rich repeat 195..218 CDD:275380 8/39 (21%)
leucine-rich repeat 219..242 CDD:275380 9/96 (9%)
LRR_8 241..301 CDD:290566 11/62 (18%)
leucine-rich repeat 243..311 CDD:275380 13/81 (16%)
leucine-rich repeat 312..335 CDD:275380 5/24 (21%)
LRR_8 334..415 CDD:290566 30/90 (33%)
leucine-rich repeat 336..359 CDD:275380 8/26 (31%)
leucine-rich repeat 360..380 CDD:275380 9/22 (41%)
LRR_8 379..460 CDD:290566 22/88 (25%)
LRR_4 379..>415 CDD:289563 14/41 (34%)
leucine-rich repeat 381..404 CDD:275380 6/25 (24%)
leucine-rich repeat 405..449 CDD:275380 10/43 (23%)
Toll-4NP_523519.2 leucine-rich repeat 264..287 CDD:275380
leucine-rich repeat 288..308 CDD:275380
leucine-rich repeat 309..334 CDD:275380
leucine-rich repeat 335..386 CDD:275380 2/3 (67%)
leucine-rich repeat 388..408 CDD:275380 4/26 (15%)
LRR_8 412..465 CDD:290566 14/52 (27%)
leucine-rich repeat 412..432 CDD:275378 6/19 (32%)
LRR_4 432..470 CDD:289563 9/37 (24%)
leucine-rich repeat 433..454 CDD:275378 6/20 (30%)
leucine-rich repeat 455..478 CDD:275378 4/22 (18%)
leucine-rich repeat 479..490 CDD:275378 3/10 (30%)
leucine-rich repeat 632..657 CDD:275378 3/24 (13%)
leucine-rich repeat 658..679 CDD:275378 0/20 (0%)
leucine-rich repeat 680..706 CDD:275378 7/25 (28%)
leucine-rich repeat 707..719 CDD:275378 3/23 (13%)
leucine-rich repeat 771..791 CDD:275380 5/19 (26%)
leucine-rich repeat 793..815 CDD:275378 9/21 (43%)
leucine-rich repeat 816..835 CDD:275378 6/18 (33%)
leucine-rich repeat 836..859 CDD:275378 8/23 (35%)
TIR 974..1110 CDD:214587
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45453551
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.