Sequence 1: | NP_001262529.1 | Gene: | 2mit / 41616 | FlyBaseID: | FBgn0260793 | Length: | 1155 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001384.1 | Gene: | ECM2 / 1842 | HGNCID: | 3154 | Length: | 699 | Species: | Homo sapiens |
Alignment Length: | 347 | Identity: | 91/347 - (26%) |
---|---|---|---|
Similarity: | 141/347 - (40%) | Gaps: | 90/347 - (25%) |
- Green bases have known domain annotations that are detailed below.
Fly 218 ELQTLVLSHNNISDIDYETFLALPNLQYLDLSHNRLSGSAIRALQGIPDLVSLSIAYNPDVGVAM 282
Fly 283 QEFVASWSLKELDASGTGLCQVPAALAQSVRTLKLSDNWLKAINCGDMDSYPLLQYLDLSHSRI- 346
Fly 347 -AQVEDDALGRLELLESLFLDRNLLMRVPSSLPPSLEHLFLQHNQIME----------------- 393
Fly 394 ---------LPPQAFVGLVNLQTLDLSNNRLIFLPPLSLPK-LLTLNLESSGVESVSQSIV-HTL 447
Fly 448 PQLRDLLLEDNPIKCSDLLGIAEWASPCRSVDAGQSNGASVSGRVDLKTEYLQFHNFYENFSSRE 512
Fly 513 CGIRKPENDTK--PPSCSLTRA 532 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
2mit | NP_001262529.1 | LRR_RI | 124..355 | CDD:238064 | 38/138 (28%) |
leucine-rich repeat | 124..143 | CDD:275380 | |||
leucine-rich repeat | 144..167 | CDD:275380 | |||
leucine-rich repeat | 172..194 | CDD:275380 | |||
LRR_8 | 193..253 | CDD:290566 | 16/34 (47%) | ||
leucine-rich repeat | 195..218 | CDD:275380 | 91/347 (26%) | ||
leucine-rich repeat | 219..242 | CDD:275380 | 8/22 (36%) | ||
LRR_8 | 241..301 | CDD:290566 | 14/59 (24%) | ||
leucine-rich repeat | 243..311 | CDD:275380 | 16/67 (24%) | ||
leucine-rich repeat | 312..335 | CDD:275380 | 6/22 (27%) | ||
LRR_8 | 334..415 | CDD:290566 | 30/108 (28%) | ||
leucine-rich repeat | 336..359 | CDD:275380 | 7/24 (29%) | ||
leucine-rich repeat | 360..380 | CDD:275380 | 7/19 (37%) | ||
LRR_8 | 379..460 | CDD:290566 | 32/108 (30%) | ||
LRR_4 | 379..>415 | CDD:289563 | 16/61 (26%) | ||
leucine-rich repeat | 381..404 | CDD:275380 | 9/48 (19%) | ||
leucine-rich repeat | 405..449 | CDD:275380 | 16/45 (36%) | ||
ECM2 | NP_001384.1 | VWC | 103..157 | CDD:278520 | |
Amnionless | <116..>213 | CDD:317263 | |||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 176..316 | ||||
Cell attachment site. /evidence=ECO:0000255 | 294..296 | ||||
NEL | <320..>572 | CDD:330839 | 72/250 (29%) | ||
leucine-rich repeat | 321..344 | CDD:275380 | 91/347 (26%) | ||
leucine-rich repeat | 345..368 | CDD:275380 | 8/22 (36%) | ||
LRR 1 | 368..388 | 9/41 (22%) | |||
leucine-rich repeat | 369..394 | CDD:275380 | 9/46 (20%) | ||
LRR 2 | 394..415 | 7/20 (35%) | |||
leucine-rich repeat | 395..415 | CDD:275380 | 7/19 (37%) | ||
leucine-rich repeat | 416..439 | CDD:275380 | 6/22 (27%) | ||
LRR 3 | 416..436 | 6/19 (32%) | |||
LRR 4 | 439..459 | 5/19 (26%) | |||
leucine-rich repeat | 440..465 | CDD:275380 | 7/24 (29%) | ||
LRR 5 | 465..484 | 5/18 (28%) | |||
leucine-rich repeat | 466..486 | CDD:275380 | 7/19 (37%) | ||
LRR 6 | 486..507 | 8/20 (40%) | |||
leucine-rich repeat | 487..510 | CDD:275380 | 7/22 (32%) | ||
LRR | 491..>673 | CDD:227223 | 42/178 (24%) | ||
LRR 7 | 510..530 | 1/19 (5%) | |||
leucine-rich repeat | 511..536 | CDD:275380 | 2/24 (8%) | ||
LRR 8 | 536..557 | 10/21 (48%) | |||
LRR 9 | 558..578 | 5/19 (26%) | |||
LRR 10 | 582..602 | 7/46 (15%) | |||
leucine-rich repeat | 583..606 | CDD:275380 | 8/49 (16%) | ||
LRR 11 | 609..630 | 7/28 (25%) | |||
leucine-rich repeat | 610..632 | CDD:275380 | 7/29 (24%) | ||
LRR 12 | 632..653 | 1/1 (100%) | |||
leucine-rich repeat | 633..653 | CDD:275380 | 91/347 (26%) | ||
LRR 13 | 661..684 | ||||
leucine-rich repeat | 662..687 | CDD:275380 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 1 | 1.000 | - | - | otm40317 | |
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
1 | 1.000 |