DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment 2mit and PODN

DIOPT Version :9

Sequence 1:NP_001262529.1 Gene:2mit / 41616 FlyBaseID:FBgn0260793 Length:1155 Species:Drosophila melanogaster
Sequence 2:XP_016855783.1 Gene:PODN / 127435 HGNCID:23174 Length:652 Species:Homo sapiens


Alignment Length:508 Identity:138/508 - (27%)
Similarity:217/508 - (42%) Gaps:104/508 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 DIPT-SSRLAAEREE-QQLSRQDVGRLSYQSIHRM--LRDENEPDSFRGELRYQQKRHKRELE-L 92
            |:|. ::.|:.:..: :::..:::.||     ||:  |..:|...:.|| |..:...|...|. |
Human   132 DLPEHTNHLSLQNNQLEKIYPEELSRL-----HRLETLNLQNNRLTSRG-LPEKAFEHLTNLNYL 190

  Fly    93 NAPANKLNLTHRDLRTFNSTGGQWKGDFQVITAMDLSSNQLESLSLDNFNQ---LRQLDLGNNSL 154
            ....|||.|..|.|.             ..:.::|.::|.|..:....|.|   ||.:.|.||  
Human   191 YLANNKLTLAPRFLP-------------NALISVDFAANYLTKIYGLTFGQKPNLRSVYLHNN-- 240

  Fly   155 EVIPLSLADTNMSLPFVTLDLSCNKFSQISTSFFAQRLPQ-----LKNLNLAHNELLNISRESFY 214
                 .|||.  .||....:.|.|....|.:|.|.:.:|:     |..|:|.:|:|..|...:|.
Human   241 -----KLADA--GLPDNMFNGSSNVEVLILSSNFLRHVPKHLPPALYKLHLKNNKLEKIPPGAFS 298

  Fly   215 NLLELQTLVLSHNNISD--IDYETFLALPNLQYLDLSHNRLSGSAIRALQGIP-DLVSLSIAYNP 276
            .|..|:.|.|.:|.::|  :|.|||..|.:|:|||||.|.||    |...|:| .||.|.:..|.
Human   299 ELSSLRELYLQNNYLTDEGLDNETFWKLSSLEYLDLSSNNLS----RVPAGLPRSLVLLHLEKNA 359

  Fly   277 --------------------------DVGVAMQEFVASWSLKELDASGTGLCQVPAALAQSVRTL 315
                                      :.|:....|.....|..:......|.:||:.|.:.||||
Human   360 IRSVDANVLTPIRSLEYLLLHSNQLREQGIHPLAFQGLKRLHTVHLYNNALERVPSGLPRRVRTL 424

  Fly   316 KLSDNWLKAINCGDMDSYPLLQYLDLSHSRIA--QVEDDALGRLELLESLFLDRNLLMRVPSSLP 378
            .:..|.:..|...|..:...|:.|:||::||.  ||..||..:|.||.||.|..|.|..:|..||
Human   425 MILHNQITGIGREDFATTYFLEELNLSYNRITSPQVHRDAFRKLRLLRSLDLSGNRLHTLPPGLP 489

  Fly   379 ------------------------PSLEHLFLQHNQIME--LPPQAFVGLVNLQTLDLSNNRLIF 417
                                    ..|..|:|..|::..  |.|:|:|.|.:||.||::.|:|..
Human   490 RNVHVLKVKRNELAALARGALVGMAQLRELYLTSNRLRSRALGPRAWVDLAHLQLLDIAGNQLTE 554

  Fly   418 LPPLSLPKLLT-LNLESSGVESVSQSIVHTLPQLRDLLLEDNPIKCSDLLGIA 469
            :|. .||:.|. |.|:::.:.:|..:...:.|.|:.:.|..|.:....::..|
Human   555 IPE-GLPESLEYLYLQNNKISAVPANAFDSTPNLKGIFLRFNKLAVGSVVDSA 606

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
2mitNP_001262529.1 LRR_RI 124..355 CDD:238064 79/269 (29%)
leucine-rich repeat 124..143 CDD:275380 4/18 (22%)
leucine-rich repeat 144..167 CDD:275380 8/22 (36%)
leucine-rich repeat 172..194 CDD:275380 5/21 (24%)
LRR_8 193..253 CDD:290566 26/66 (39%)
leucine-rich repeat 195..218 CDD:275380 8/22 (36%)
leucine-rich repeat 219..242 CDD:275380 10/24 (42%)
LRR_8 241..301 CDD:290566 19/86 (22%)
leucine-rich repeat 243..311 CDD:275380 23/94 (24%)
leucine-rich repeat 312..335 CDD:275380 7/22 (32%)
LRR_8 334..415 CDD:290566 35/108 (32%)
leucine-rich repeat 336..359 CDD:275380 11/24 (46%)
leucine-rich repeat 360..380 CDD:275380 9/43 (21%)
LRR_8 379..460 CDD:290566 26/83 (31%)
LRR_4 379..>415 CDD:289563 14/37 (38%)
leucine-rich repeat 381..404 CDD:275380 9/24 (38%)
leucine-rich repeat 405..449 CDD:275380 13/44 (30%)
PODNXP_016855783.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm40317
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.