DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment 2mit and si:dkey-182i3.11

DIOPT Version :9

Sequence 1:NP_001262529.1 Gene:2mit / 41616 FlyBaseID:FBgn0260793 Length:1155 Species:Drosophila melanogaster
Sequence 2:XP_021322095.1 Gene:si:dkey-182i3.11 / 100334238 ZFINID:ZDB-GENE-121214-258 Length:710 Species:Danio rerio


Alignment Length:446 Identity:120/446 - (26%)
Similarity:202/446 - (45%) Gaps:69/446 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    90 LELNAPAN-----KLNLTHRDLRTFNSTGGQWKG-----------------------DFQVITAM 126
            :|:|...|     ||.|:...|::..:  |.:||                       :...:|::
Zfish   214 IEMNVFENCTYLAKLYLSKNKLKSVGN--GSFKGATGLNHLDLGLNGLAGIPTIVLQETSNLTSL 276

  Fly   127 DLSSNQLESLSLDNFNQ---LRQLDLGNNSLEVIPLSLADTNMSLPFVTLDLSCNKFSQISTSFF 188
            .|..|.:.|:..:.|::   |:.|||..|.|  :.:|..........|.||||.|:...::...|
Zfish   277 YLQKNDITSIPDNVFSEILSLKHLDLSYNGL--VSISNGSFRSLSQLVYLDLSFNQLQTLTQHVF 339

  Fly   189 AQRLPQLKNLNLAHNELLNISRESFYNLLELQTLVLSHNNISDIDYETFLALPNLQYLDLSHNRL 253
             :.|.:|:||||.||:|.::....|.||..|:.|.|..||||.|..:.|..|..|:.|.|.:|.:
Zfish   340 -EDLGKLENLNLYHNKLTSLPNNMFKNLTMLKELQLDSNNISVIPPDLFHPLSALKDLQLDNNHI 403

  Fly   254 SGSAIRALQGIPDLVSLSIAYNPDVGVA-------MQE---------FVASWS------LKELDA 296
            |.......:.:..|..|.|:.|....:.       ::|         |::.:|      |:.|..
Zfish   404 SKLHSHTFKKLRQLKQLDISSNDLTKIPNHLFHKNLKELNLENNHISFISKFSFKNLHRLQSLKL 468

  Fly   297 SGTGLCQVPAALAQS---VRTLKLSDNWLKAINCGDMDSYPLLQYLDLSHSRIAQVEDDALGRLE 358
            |...|.::...|..:   :|.|.|::|.::.|..|.......|:.||||::::..:..||...|.
Zfish   469 SHNNLSKLYRELLTNLTRLRELLLNENQIETIPVGFFKGLENLRVLDLSNNKMHFILPDAFNDLS 533

  Fly   359 LLESLFLDRNLLMRVPSSLPPSLEH---LFLQHNQIMELPPQAFVGLVNLQTLDLSNNRLIFLPP 420
            .|:.|.|..|.|..:|..:..||.:   |.||:|::..||.:.|..||.|:.|.|..|.:..:.|
Zfish   534 ALKDLDLSFNFLHNLPEDIFASLRNLTKLHLQNNKLRYLPSRLFSALVGLEELHLDRNYIQRIHP 598

  Fly   421 L---SLPKLLTLNLESSGVESVSQSIVHTLPQLRDLLLEDNPIKCSD--LLGIAEW 471
            .   .|.||..|:::|:.:.|:....:..|.:|:.:.|:.||..||.  :|.|::|
Zfish   599 TQFEGLVKLHELDMKSNQLRSMEDGTLMPLRKLKRIHLDGNPWDCSTVVILYISQW 654

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
2mitNP_001262529.1 LRR_RI 124..355 CDD:238064 71/258 (28%)
leucine-rich repeat 124..143 CDD:275380 5/18 (28%)
leucine-rich repeat 144..167 CDD:275380 7/22 (32%)
leucine-rich repeat 172..194 CDD:275380 7/21 (33%)
LRR_8 193..253 CDD:290566 25/59 (42%)
leucine-rich repeat 195..218 CDD:275380 11/22 (50%)
leucine-rich repeat 219..242 CDD:275380 10/22 (45%)
LRR_8 241..301 CDD:290566 15/81 (19%)
leucine-rich repeat 243..311 CDD:275380 17/89 (19%)
leucine-rich repeat 312..335 CDD:275380 6/22 (27%)
LRR_8 334..415 CDD:290566 29/83 (35%)
leucine-rich repeat 336..359 CDD:275380 8/22 (36%)
leucine-rich repeat 360..380 CDD:275380 6/19 (32%)
LRR_8 379..460 CDD:290566 26/86 (30%)
LRR_4 379..>415 CDD:289563 15/38 (39%)
leucine-rich repeat 381..404 CDD:275380 9/25 (36%)
leucine-rich repeat 405..449 CDD:275380 12/46 (26%)
si:dkey-182i3.11XP_021322095.1 PLN00113 97..>617 CDD:331614 109/407 (27%)
leucine-rich repeat 129..152 CDD:275380
leucine-rich repeat 153..176 CDD:275380
leucine-rich repeat 177..200 CDD:275380
leucine-rich repeat 201..224 CDD:275380 3/9 (33%)
leucine-rich repeat 225..248 CDD:275380 7/24 (29%)
leucine-rich repeat 249..272 CDD:275380 0/22 (0%)
leucine-rich repeat 273..296 CDD:275380 5/22 (23%)
leucine-rich repeat 297..320 CDD:275380 7/24 (29%)
leucine-rich repeat 321..344 CDD:275380 8/23 (35%)
leucine-rich repeat 345..368 CDD:275380 11/22 (50%)
leucine-rich repeat 369..392 CDD:275380 10/22 (45%)
leucine-rich repeat 393..438 CDD:275380 9/44 (20%)
leucine-rich repeat 417..436 CDD:275380 4/18 (22%)
leucine-rich repeat 439..462 CDD:275380 3/22 (14%)
leucine-rich repeat 463..486 CDD:275380 5/22 (23%)
leucine-rich repeat 487..510 CDD:275380 6/22 (27%)
leucine-rich repeat 511..534 CDD:275380 8/22 (36%)
leucine-rich repeat 535..558 CDD:275380 8/22 (36%)
leucine-rich repeat 559..582 CDD:275380 8/22 (36%)
leucine-rich repeat 583..606 CDD:275380 6/22 (27%)
leucine-rich repeat 607..628 CDD:275380 4/20 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
32.870

Return to query results.
Submit another query.