powered by:
Protein Alignment CG7966 and F42G8.8
DIOPT Version :9
Sequence 1: | NP_650256.2 |
Gene: | CG7966 / 41610 |
FlyBaseID: | FBgn0038115 |
Length: | 486 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_501356.2 |
Gene: | F42G8.8 / 185677 |
WormBaseID: | WBGene00018359 |
Length: | 383 |
Species: | Caenorhabditis elegans |
Alignment Length: | 61 |
Identity: | 18/61 - (29%) |
Similarity: | 23/61 - (37%) |
Gaps: | 14/61 - (22%) |
- Green bases have known domain annotations that are detailed below.
Fly 329 RFLYVNCWRHGDVRQYDITDPENPKLTGQLFLGGAICSDLPNVIVKEDKELKE-RPPARYV 388
|.|.|..| .:.||.:.|..|..:|. ||....:|||..|.: .||...|
Worm 15 RHLIVKSW--ANYRQLEYTKSELIQLI-----------DLVTPALKEDNSLAQISPPVTIV 62
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_KOG0918 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.