DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7966 and F42G8.8

DIOPT Version :9

Sequence 1:NP_650256.2 Gene:CG7966 / 41610 FlyBaseID:FBgn0038115 Length:486 Species:Drosophila melanogaster
Sequence 2:NP_501356.2 Gene:F42G8.8 / 185677 WormBaseID:WBGene00018359 Length:383 Species:Caenorhabditis elegans


Alignment Length:61 Identity:18/61 - (29%)
Similarity:23/61 - (37%) Gaps:14/61 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   329 RFLYVNCWRHGDVRQYDITDPENPKLTGQLFLGGAICSDLPNVIVKEDKELKE-RPPARYV 388
            |.|.|..|  .:.||.:.|..|..:|.           ||....:|||..|.: .||...|
 Worm    15 RHLIVKSW--ANYRQLEYTKSELIQLI-----------DLVTPALKEDNSLAQISPPVTIV 62

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7966NP_650256.2 SBP56 6..482 CDD:283374 18/61 (30%)
LVIVD repeat 321..358 CDD:293789 9/28 (32%)
F42G8.8NP_501356.2 PP2Ac 30..322 CDD:197547 12/44 (27%)
MPP_PPP_family 60..310 CDD:277316 1/3 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0918
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.