DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11670 and gzma

DIOPT Version :9

Sequence 1:NP_001368950.1 Gene:CG11670 / 41608 FlyBaseID:FBgn0038114 Length:431 Species:Drosophila melanogaster
Sequence 2:XP_001335166.1 Gene:gzma / 795070 ZFINID:ZDB-GENE-091204-156 Length:257 Species:Danio rerio


Alignment Length:245 Identity:74/245 - (30%)
Similarity:114/245 - (46%) Gaps:46/245 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   191 NENHEIDYKCGGSLISEEFVLTAAHCLTTHGTSPDIVKIGDIKLKEWELNVAPQRRRVAQIYLHP 255
            |:||    ||||.||.:|:|||||||.....:|..:: ||.:.|.:     ..||..:....:..
Zfish    47 NQNH----KCGGILIHKEWVLTAAHCKEDSYSSVTVL-IGSLSLSK-----GSQRIAIHNYEIPE 101

  Fly   256 LYNASLNYHDIGLIQLNRPVEYTWFVRPVRLWPM--NDI-PYGKLHTMGYGSTGFAQPQ-TNILT 316
            .:|......||.||:|::.|:    .:|.:: |.  .|: |..|....|:|:|.:...| ::.|.
Zfish   102 TFNKKTKKDDIMLIRLSKKVK----AKPYKI-PKKEKDVQPGTKCVVRGWGTTDYKGKQASDKLQ 161

  Fly   317 ELDLSVVPIEQCN---SSLPADEGSPHGLLTSQICAHDYEKNRDTCQGDSGGPLQLNLERRRRRH 378
            .|::.||...|||   :..|.       :....:||.:.:::|.||.|||||||:....      
Zfish   162 MLEVLVVDRVQCNRYYNRNPV-------ITKDMLCAGNTQQHRGTCLGDSGGPLECEKN------ 213

  Fly   379 TSRKHYRYYLVGITSYGAYCRS-ELPGVYTRVSS-YIDWIASIVWPNYYS 426
                     |||:.|....|.. :.|.|||.:|. :|.||..|:...:.|
Zfish   214 ---------LVGVLSGSHGCGDPKKPTVYTLLSKRHITWINKILKQQFNS 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11670NP_001368950.1 Tryp_SPc 172..419 CDD:238113 72/236 (31%)
gzmaXP_001335166.1 Tryp_SPc 28..247 CDD:238113 72/236 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1144875at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.