DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11670 and CG34290

DIOPT Version :9

Sequence 1:NP_001368950.1 Gene:CG11670 / 41608 FlyBaseID:FBgn0038114 Length:431 Species:Drosophila melanogaster
Sequence 2:NP_001097899.2 Gene:CG34290 / 5740609 FlyBaseID:FBgn0085319 Length:282 Species:Drosophila melanogaster


Alignment Length:279 Identity:80/279 - (28%)
Similarity:120/279 - (43%) Gaps:73/279 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   172 GRSIVAPG----QYPHMAALG---FRNENHEIDYK--CGGSLISEEFVLTAAHCL---TTHGTS- 223
            ||.:...|    :||.|.:|.   .||..:.:.|:  |||||||:.::|:||||:   ..|..: 
  Fly    37 GRIVSTVGSSTSKYPFMVSLQDVITRNTTNGVSYQHFCGGSLISDRWILSAAHCVWRKNIHYIAA 101

  Fly   224 ----PDIVKIGDIKLKEWELNVAPQRRRVAQIYLHPLYNASLNY-HDIGLIQLNRPVEYTWFVRP 283
                .:|..||  :|:.:.|      ..|..||..|     .|: :||.|:.:.|          
  Fly   102 FIGYENIENIG--QLQPYGL------ESVEYIYFQP-----SNFRNDIALLYMKR---------- 143

  Fly   284 VRLWP--MNDIPYGKL--HTM-----------GYGSTGFAQPQTNILTELDLSVVPIEQCNSSLP 333
             |.|.  .|.:.|.:|  |.|           |||:|..|.|....|.|.::.|:..::|...:.
  Fly   144 -RYWSDFGNGLQYAQLPPHGMKPDQNESCRIIGYGATHHAGPCQKRLFEAEVRVIDNQKCRDIIG 207

  Fly   334 ADEGSPHGLLTSQICAHDYEKNRDTCQGDSGGPLQLNLERRRRRHTSRKHYRYYLVGITSYGAYC 398
            ......:|..|  :||  ...|:|:|||||||||......:.           |:.|:.|:|..|
  Fly   208 HIWAPQNGANT--VCA--LGNNQDSCQGDSGGPLICTYGGKD-----------YIYGLVSHGLTC 257

  Fly   399 R-SELPGVYTRVSSYIDWI 416
            . ..:|.:||....|.||:
  Fly   258 GIPGMPSIYTVTRPYYDWV 276

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11670NP_001368950.1 Tryp_SPc 172..419 CDD:238113 80/279 (29%)
CG34290NP_001097899.2 Tryp_SPc 34..277 CDD:238113 80/279 (29%)
Tryp_SPc 34..276 CDD:214473 79/277 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45456096
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.