DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11670 and si:dkey-21e2.10

DIOPT Version :9

Sequence 1:NP_001368950.1 Gene:CG11670 / 41608 FlyBaseID:FBgn0038114 Length:431 Species:Drosophila melanogaster
Sequence 2:XP_009294620.1 Gene:si:dkey-21e2.10 / 556860 ZFINID:ZDB-GENE-050208-778 Length:249 Species:Danio rerio


Alignment Length:251 Identity:80/251 - (31%)
Similarity:115/251 - (45%) Gaps:46/251 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   178 PGQYPHMAALGFRNENHEIDYK---CGGSLISEEFVLTAAHCLTTHGTSPDIVKIGDIKLKEWEL 239
            |...|:|.:|.|        ||   ||||||:||||||||||.........:....|::.|... 
Zfish    32 PHSRPYMVSLQF--------YKLHMCGGSLITEEFVLTAAHCWEEDDVLTVVTGAHDLRKKAIN- 87

  Fly   240 NVAPQRRRVAQIYLHPLYNASLNYHDIGLIQLNRPVEYTWFVRPVRLWPMN--DIPYGKLHTM-G 301
            ||    .:|.....||.:|:....:||.|:||...|..:..|..:.| |.:  |:....|.:: |
Zfish    88 NV----YKVKSYIPHPDFNSKTLENDIMLLQLKTKVRLSNNVGLISL-PKDGEDVKADTLCSVAG 147

  Fly   302 YGSTGFAQPQTNILTELDLSVVPIEQCNSSLPADEGSPHGLLTSQICAHDYEKNRDTCQGDSGGP 366
            :|......|:|:.|.|.:..:|...:|.....:|.     :.:..||.:.:   ..||.||||||
Zfish   148 WGDLWSKGPETDRLREAETVIVNNAECERRWESDY-----VASKMICVYGH---GGTCSGDSGGP 204

  Fly   367 LQLNLERRRRRHTSRKHYRYYLVGITSYGA--YCRSEL-PGVYTRVSSYIDWIASI 419
            |...               ..:|||||:|.  .|.|.| |.|:||:|:|:.||.:|
Zfish   205 LVCG---------------DTVVGITSFGEPYLCNSRLFPDVHTRISAYLPWIHNI 245

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11670NP_001368950.1 Tryp_SPc 172..419 CDD:238113 79/249 (32%)
si:dkey-21e2.10XP_009294620.1 Tryp_SPc 27..242 CDD:214473 77/246 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D476534at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.