DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11670 and CG11843

DIOPT Version :9

Sequence 1:NP_001368950.1 Gene:CG11670 / 41608 FlyBaseID:FBgn0038114 Length:431 Species:Drosophila melanogaster
Sequence 2:NP_001287578.1 Gene:CG11843 / 43432 FlyBaseID:FBgn0039630 Length:316 Species:Drosophila melanogaster


Alignment Length:252 Identity:91/252 - (36%)
Similarity:128/252 - (50%) Gaps:29/252 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   178 PGQYPHMAALGFR-NENHEIDYKCGGSLISEEFVLTAAHCLTTHGTSPDIVKIGDIKLKEWELNV 241
            |.::||||.||.| :.:...|:.|||.||||.|||||||||.:.....::|::|::.....:.:.
  Fly    76 PREFPHMARLGRRPDPSSRADWFCGGVLISERFVLTAAHCLESERGEVNVVRLGELDFDSLDEDA 140

  Fly   242 APQRRRVAQIYLHPLYNASLNYHDIGLIQLNRPVEYTWFVRPVRLWPMNDIPYGKLHTMGYGSTG 306
            ||:...||....||.|.....||||||::|...|.:..:..|..|...::........:|:||||
  Fly   141 APRDYMVAGYIAHPGYEDPQFYHDIGLVKLTEAVVFDLYKHPACLPFQDERSSDSFIAVGWGSTG 205

  Fly   307 FA-QPQTNILTELDLSVVPIEQ-----CNSSLPAD-EGSPHGL-LTSQICAHDYEKNRDTCQGDS 363
            .| :|...:|.      |.:::     |...|... |..|.|. ..:|:|... |..:|||.|||
  Fly   206 LALKPSAQLLK------VKLQRYGNWVCKKLLTRQVEEFPRGFDGNNQLCVGS-EMAQDTCNGDS 263

  Fly   364 GGPLQLNLERRRRRHTSRKHY--RYYLVGITSYGAYCRSE-LPGVYTRVSSYIDWIA 417
            ||||.:          ..:.|  .|.:|||||.|..|.|. :||:||||..|:.|||
  Fly   264 GGPLLM----------YHREYPCMYVVVGITSAGLSCGSPGIPGIYTRVYPYLGWIA 310

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11670NP_001368950.1 Tryp_SPc 172..419 CDD:238113 91/252 (36%)
CG11843NP_001287578.1 Tryp_SPc 68..312 CDD:238113 91/252 (36%)
Tryp_SPc 68..309 CDD:214473 88/249 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D105391at6960
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.