DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11670 and CG11842

DIOPT Version :9

Sequence 1:NP_001368950.1 Gene:CG11670 / 41608 FlyBaseID:FBgn0038114 Length:431 Species:Drosophila melanogaster
Sequence 2:NP_651662.1 Gene:CG11842 / 43431 FlyBaseID:FBgn0039629 Length:319 Species:Drosophila melanogaster


Alignment Length:272 Identity:84/272 - (30%)
Similarity:132/272 - (48%) Gaps:61/272 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   172 GRSIVAPGQYPHMAALGFRNENHEIDYKCGGSLISEEFVLTAAHCLTTHGTSPDIVKIGDIKLKE 236
            |.....|.::||.|.||.::||.|:::.|||:|||:..|||||||..:...|.:|.::||::...
  Fly    75 GGGPAVPKEFPHAARLGHKDENGEVEWFCGGTLISDRHVLTAAHCHYSPQGSVNIARLGDLEFDT 139

  Fly   237 WELNVAPQRRRVAQIYLHPLYNASLNYHDIGLIQLNRPVEYTWFVRPVRLWPMNDIPYGKLHT-- 299
            ...:..|:...|.....||.::....|:||.:::|:|||.:..:..|..| |.:|   |:|.|  
  Fly   140 NNDDADPEDFDVKDFTAHPEFSYPAIYNDISVVRLSRPVTFNDYKHPACL-PFDD---GRLGTSF 200

  Fly   300 --MGYGSTGFAQPQTNILTELDLSVVPIEQ---------------CNSSLPADEGSPHGL-LTSQ 346
              :|:|               .|.:||..:               |..:...::..|.|. .|:|
  Fly   201 IAIGWG---------------QLEIVPRTENKKLQKVKLYNYGTRCRITADRNDELPEGYNATTQ 250

  Fly   347 ICAHDYEKNRDTCQGDSGGPLQLNLERRRRRHTSRKHYR------YYLVGITSYGAYCRS-ELPG 404
            :|....| ::|||.||||||:.:              |.      |:::||||.|..|.: :||.
  Fly   251 LCIGSNE-HKDTCNGDSGGPVLI--------------YHMDYPCMYHVMGITSIGVACDTPDLPA 300

  Fly   405 VYTRVSSYIDWI 416
            :||||..|:|||
  Fly   301 MYTRVHFYLDWI 312

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11670NP_001368950.1 Tryp_SPc 172..419 CDD:238113 84/272 (31%)
CG11842NP_651662.1 Tryp_SPc 73..315 CDD:238113 84/272 (31%)
Tryp_SPc 73..312 CDD:214473 82/270 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D105391at6960
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.