DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11670 and snk

DIOPT Version :9

Sequence 1:NP_001368950.1 Gene:CG11670 / 41608 FlyBaseID:FBgn0038114 Length:431 Species:Drosophila melanogaster
Sequence 2:NP_001097766.1 Gene:snk / 41607 FlyBaseID:FBgn0003450 Length:435 Species:Drosophila melanogaster


Alignment Length:292 Identity:106/292 - (36%)
Similarity:155/292 - (53%) Gaps:34/292 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   155 ENYNKTAETEDLHD---DFNGRSIVAP------------GQYPHMAALGFR----NENHEIDYKC 200
            :.||..|....|.|   .|:|:..|..            |.:|||||||:.    :::.:|.:.|
  Fly   156 QEYNAAARRLHLTDTGRTFSGKQCVPSVPLIVGGTPTRHGLFPHMAALGWTQGSGSKDQDIKWGC 220

  Fly   201 GGSLISEEFVLTAAHCLTTHGTSPDIVKIGDIKLKEWELNVAPQRRRVAQIYLHPLYNASLNYHD 265
            ||:|:||.:|||||||.|:....||:|::|..:|.  |.:...|..::..|.|||.|.:|..|||
  Fly   221 GGALVSELYVLTAAHCATSGSKPPDMVRLGARQLN--ETSATQQDIKILIIVLHPKYRSSAYYHD 283

  Fly   266 IGLIQLNRPVEYTWFVRPVRLWPMNDIPYGKLHTMGYGSTGFAQPQTNILTELDLSVVPIEQCNS 330
            |.|::|.|.|:::..|||..||.:.::....:...|:|.|.|...::|.|.::||.|||...|..
  Fly   284 IALLKLTRRVKFSEQVRPACLWQLPELQIPTVVAAGWGRTEFLGAKSNALRQVDLDVVPQMTCKQ 348

  Fly   331 SLPADEGSPHGLLTSQICAHDYEKNRDTCQGDSGGPLQLNLERRRRRHTSRKHYR--YYLVGITS 393
            ....:...|.|::..|.||......|||||||||||:          |.....|.  .::|||||
  Fly   349 IYRKERRLPRGIIEGQFCAGYLPGGRDTCQGDSGGPI----------HALLPEYNCVAFVVGITS 403

  Fly   394 YGAYCRS-ELPGVYTRVSSYIDWIASIVWPNY 424
            :|.:|.: ..||||||:.||:|||..|.:..:
  Fly   404 FGKFCAAPNAPGVYTRLYSYLDWIEKIAFKQH 435

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11670NP_001368950.1 Tryp_SPc 172..419 CDD:238113 99/265 (37%)
snkNP_001097766.1 CLIP 93..139 CDD:197829
Tryp_SPc 186..430 CDD:238113 97/255 (38%)
Tryp_SPc 186..427 CDD:214473 95/252 (38%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D105391at6960
OrthoFinder 1 1.000 - - FOG0012732
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.