DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11670 and CG10041

DIOPT Version :9

Sequence 1:NP_001368950.1 Gene:CG11670 / 41608 FlyBaseID:FBgn0038114 Length:431 Species:Drosophila melanogaster
Sequence 2:NP_650177.2 Gene:CG10041 / 41496 FlyBaseID:FBgn0038014 Length:287 Species:Drosophila melanogaster


Alignment Length:262 Identity:70/262 - (26%)
Similarity:112/262 - (42%) Gaps:73/262 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   180 QYPHMAALGFRNENHEIDYK--CGGSLISEEFVLTAAHCLTTHGTSPDIVKIG-DIKLKEWELNV 241
            :||::.::|   ||.:..||  |.|.::|.||||:||||:.|:.|....|..| |      .||.
  Fly    49 RYPYIVSIG---ENLKGYYKHLCVGVILSNEFVLSAAHCIQTNPTKQLYVAGGAD------SLNS 104

  Fly   242 APQRR-RVAQIYLHPLYNASLNYHDIGLIQLNRPVEYTWFVRPVRLWPMNDIPYGKLH------- 298
            ..|.| .|.:...||.:.. |..:||.::::     |..|       |::|:.:..::       
  Fly   105 RKQTRFFVVERRWHPQFRV-LGGNDIAVLRI-----YPKF-------PLDDVRFRSINFAGKPQR 156

  Fly   299 -------TMGYGSTGFAQPQTNILTELDLSVVPIEQCNSS------LPADEGSPHGLLTSQICAH 350
                   .:|:|..|..:.:.  |.|:....:..::|..|      .|.|           |||.
  Fly   157 DSGTQASLVGWGRVGVGKIRK--LQEMPFLTMENDECQQSHRFVFLKPLD-----------ICAM 208

  Fly   351 DYEKNRDTCQGDSGGPLQLNLERRRRRHTSRKHYRYYLVGITSYG-AYCRSELPGVYTRVSSYID 414
            ..:..|..|.||||.|| :|:.:.:            |.|:.||| ..|....|..:||:::|..
  Fly   209 HLKGPRGPCDGDSGAPL-MNVAKEK------------LYGLLSYGRKACTPLKPYAFTRINAYSS 260

  Fly   415 WI 416
            ||
  Fly   261 WI 262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11670NP_001368950.1 Tryp_SPc 172..419 CDD:238113 70/262 (27%)
CG10041NP_650177.2 Tryp_SPc 49..264 CDD:238113 70/262 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45456082
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24258
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.