DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11670 and CG16749

DIOPT Version :9

Sequence 1:NP_001368950.1 Gene:CG11670 / 41608 FlyBaseID:FBgn0038114 Length:431 Species:Drosophila melanogaster
Sequence 2:NP_649881.1 Gene:CG16749 / 41111 FlyBaseID:FBgn0037678 Length:265 Species:Drosophila melanogaster


Alignment Length:253 Identity:82/253 - (32%)
Similarity:116/253 - (45%) Gaps:51/253 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   180 QYPHMAALGFRNENHEIDYKCGGSLISEEFVLTAAHCLTTHGTSPDIVKIGDIKLKEWELNVAPQ 244
            :||.:.::...:.:|    .||||:||::||:|||||......|...|:.|..|:.....||.  
  Fly    40 KYPFVISMRGSSGSH----SCGGSIISKQFVMTAAHCTDGRKASDLSVQYGVTKINATGPNVV-- 98

  Fly   245 RRRVAQIYLHPLYNASLNY-HDIGLIQLNRPVEYTWF-VRPVRL------WPMNDIPYGKLHTMG 301
              ||.:|..|..||...|| :||.|:.:..|.|:... |.||:|      .|..|.. |:...:|
  Fly    99 --RVKKIIQHEDYNPYNNYANDISLLLVEEPFEFDGVTVAPVKLPELAFATPQTDAG-GEGVLIG 160

  Fly   302 YG---STGFAQPQTNILTELDLSVVPIEQCNSSLPADEGSPHGLLTS---QICAHDYEKNRDTCQ 360
            :|   :.|:.|   :.|.|::|.|...|:|...        ||..|.   .||....|..:..|.
  Fly   161 WGLNATGGYIQ---STLQEVELKVYSDEECTER--------HGGRTDPRYHICGGVDEGGKGQCS 214

  Fly   361 GDSGGPLQLNLERRRRRHTSRKHYRYYLVGITSYGAY-CR-SELPGVYTRVSSYIDWI 416
            |||||||..|.::               |||.|:... |. :..||||.:||.|:|||
  Fly   215 GDSGGPLIYNGQQ---------------VGIVSWSIKPCTVAPYPGVYCKVSQYVDWI 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11670NP_001368950.1 Tryp_SPc 172..419 CDD:238113 82/253 (32%)
CG16749NP_649881.1 Tryp_SPc 29..257 CDD:214473 80/251 (32%)
Tryp_SPc 30..259 CDD:238113 82/253 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45456080
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.