DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11670 and CG32277

DIOPT Version :9

Sequence 1:NP_001368950.1 Gene:CG11670 / 41608 FlyBaseID:FBgn0038114 Length:431 Species:Drosophila melanogaster
Sequence 2:NP_728835.1 Gene:CG32277 / 38393 FlyBaseID:FBgn0052277 Length:261 Species:Drosophila melanogaster


Alignment Length:230 Identity:74/230 - (32%)
Similarity:105/230 - (45%) Gaps:49/230 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   198 YKCGGSLISEEFVLTAAHC----------LTTHGTSPDIVKIGDIKLKEWELNVAPQRRRVA-QI 251
            ::|||.:||...|||||||          ||.|....   .:||        ::.|:..|.| .:
  Fly    50 FRCGGVIISPNCVLTAAHCLEGRYQQVRDLTVHAQQQ---CLGD--------DMPPEHVRSAWYV 103

  Fly   252 YLHPLYNASLNY-HDIGLIQLNRPVEYTWFVRPVRLWPMNDI-PYGKLHTMGYGSTGFAQPQTN- 313
            .|.|.|.|.... .|:.:|:|:||.:.......|:: ..||: |:..|..:|:|:........| 
  Fly   104 GLSPNYCAQRGLDSDLAVIRLSRPFDIAGNASLVKI-DYNDLPPHSNLTVLGWGAINEQGHNWNQ 167

  Fly   314 ILTELDLSVVPIEQCNSSLPADEGSPHGLLTSQI-CAHDYEKN-RDTCQGDSGGPLQLNLERRRR 376
            .|.|.::.::...:|..|:    ||....:|:.: ||  ..|| ||.||||||||          
  Fly   168 CLQEANVKLISHRECIKSV----GSGWQKVTNNMFCA--LGKNARDACQGDSGGP---------- 216

  Fly   377 RHTSRKHYRYYLVGITSYGAYCRSELPGVYTRVSS 411
                 ..|....|||.|:|..|.|..||||||:||
  Fly   217 -----AIYAGRSVGIVSWGYGCGSGYPGVYTRLSS 246

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11670NP_001368950.1 Tryp_SPc 172..419 CDD:238113 74/230 (32%)
CG32277NP_728835.1 Tryp_SPc 26..246 CDD:214473 72/228 (32%)
Tryp_SPc 27..246 CDD:238113 72/228 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45456095
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.