DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11670 and CG4927

DIOPT Version :9

Sequence 1:NP_001368950.1 Gene:CG11670 / 41608 FlyBaseID:FBgn0038114 Length:431 Species:Drosophila melanogaster
Sequence 2:NP_001033953.1 Gene:CG4927 / 36852 FlyBaseID:FBgn0034139 Length:362 Species:Drosophila melanogaster


Alignment Length:276 Identity:84/276 - (30%)
Similarity:134/276 - (48%) Gaps:48/276 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   172 GRSIVAPGQYPHMAALGFRNEN-HEIDYKCGGSLISEEFVLTAAHCLTTHGTSPD---------- 225
            |.:..|..::|.||.||.|.:| .:||:.||..:|..:|||||||||.|..|...          
  Fly   107 GGAKAAGREFPFMALLGQRGKNSSQIDWDCGAIIIHPKFVLTAAHCLETSETKEQRLDPNYDGPK 171

  Fly   226 -IVKIGDIKLKEWELNVAPQRRRVAQIYLHPLY----NASLNYHDIGLIQLNRPVEYTWFVRPVR 285
             :|::|::.......:..||..||....:||.|    :.....:||.:::|.....::.:|.|..
  Fly   172 YVVRLGELDYNSTTDDAQPQDFRVLNYVVHPAYGEDDDTGSRKNDIAVVELEMEATFSEYVAPAC 236

  Fly   286 LWPMNDIPYG----KLHTMGYGSTGFAQPQTNILTELDLSVVPIEQCNSSLPADEGSPHGL-LTS 345
            | |::.   |    ::...|:|:|..:...::.|.::.|....:.:|:..|      .|.: :.:
  Fly   237 L-PLDG---GNEQLQVAAAGWGATSESGHASSHLLKVSLDRYDVAECSQRL------EHKIDVRT 291

  Fly   346 QICAHDYEKNRDTCQGDSGGPLQLNLERRRRRHTSRKHYRY----YLVGITSYGAYCRSE-LPGV 405
            |:||.....:.|||.||||||:.:            :|..|    .::||||||..|..: ||.|
  Fly   292 QLCAGSRSTSADTCYGDSGGPVFV------------QHPIYSCLKQVIGITSYGLVCGVQGLPSV 344

  Fly   406 YTRVSSYIDWIASIVW 421
            ||:|..|.|||.:|||
  Fly   345 YTKVHLYTDWIENIVW 360

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11670NP_001368950.1 Tryp_SPc 172..419 CDD:238113 81/272 (30%)
CG4927NP_001033953.1 Tryp_SPc 105..358 CDD:238113 81/272 (30%)
Tryp_SPc 105..355 CDD:214473 79/269 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45469104
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D105391at6960
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24258
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.950

Return to query results.
Submit another query.