DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11670 and psh

DIOPT Version :9

Sequence 1:NP_001368950.1 Gene:CG11670 / 41608 FlyBaseID:FBgn0038114 Length:431 Species:Drosophila melanogaster
Sequence 2:NP_573297.1 Gene:psh / 32832 FlyBaseID:FBgn0030926 Length:394 Species:Drosophila melanogaster


Alignment Length:261 Identity:96/261 - (36%)
Similarity:141/261 - (54%) Gaps:32/261 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   176 VAPGQYPHMAALGFRNENHEIDYKCGGSLISEEFVLTAAHCLTTHGTSPDIVKIGDIKLKEWELN 240
            |.||.||||||:|:  .....|::||||||:..||||||||:.|...:|..|::|.:.::..:.:
  Fly   150 VDPGVYPHMAAIGY--ITFGTDFRCGGSLIASRFVLTAAHCVNTDANTPAFVRLGAVNIENPDHS 212

  Fly   241 VAPQRRRVAQIYLHPLYNASLNYHDIGLIQLNRPVEYTWFVRPVRLW------PMNDIPYGKLHT 299
            .  |...:..:.:||.|..: .|:||.:::|.|.|..|..:||..|.      |.|    .|...
  Fly   213 Y--QDIVIRSVKIHPQYVGN-KYNDIAILELERDVVETDNIRPACLHTDATDPPSN----SKFFV 270

  Fly   300 MGYGSTGF-AQPQTNILTELDLSVVPIEQCNSSLPADEGS----PHGLLTSQICAHDYEKNRDTC 359
            .|:|.... .:.::.||....|.:||::|||.|.....||    ..|::.|.:||.|.:...|.|
  Fly   271 AGWGVLNVTTRARSKILLRAGLELVPLDQCNISYAEQPGSIRLLKQGVIDSLLCAIDQKLIADAC 335

  Fly   360 QGDSGGPL--QLNLERRRRRHTSRKHYRYYLVGITSYGAYCRSELPGVYTRVSSYIDWIASIVWP 422
            :|||||||  :||:|          ...|.::|:.|.|..|.:..||:|||||||:|:|..||||
  Fly   336 KGDSGGPLIHELNVE----------DGMYTIMGVISSGFGCATVTPGLYTRVSSYLDFIEGIVWP 390

  Fly   423 N 423
            :
  Fly   391 D 391

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11670NP_001368950.1 Tryp_SPc 172..419 CDD:238113 92/255 (36%)
pshNP_573297.1 CLIP 30..79 CDD:197829
Tryp_SPc 143..384 CDD:214473 91/252 (36%)
Tryp_SPc 144..387 CDD:238113 92/255 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 70 1.000 Domainoid score I6224
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D105391at6960
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.