DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11670 and gd

DIOPT Version :9

Sequence 1:NP_001368950.1 Gene:CG11670 / 41608 FlyBaseID:FBgn0038114 Length:431 Species:Drosophila melanogaster
Sequence 2:NP_001259479.1 Gene:gd / 32159 FlyBaseID:FBgn0000808 Length:531 Species:Drosophila melanogaster


Alignment Length:394 Identity:91/394 - (23%)
Similarity:143/394 - (36%) Gaps:134/394 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   132 RPPPNHHRNF-HNIFLNTESKVDGE-----NYNKTAETEDLH----------------------- 167
            :||...|..| ...|.....::.|.     :::.:..||.||                       
  Fly   166 KPPSTPHIQFKKKPFAQAPKEICGRIDRDLDFHLSQRTESLHVAIGEPKSSDGITSPVFVDDDED 230

  Fly   168 --------DDFNGRSI----------VAPGQYPHMAALGFRNENHEIDYKCGGSLISEEFVLTAA 214
                    |:....:|          :..|.:|.:||: :.|....:|::|||||:|...|:::|
  Fly   231 DVLEHQFVDESEAEAIESDSADSLPSITRGSWPWLAAI-YVNNLTSLDFQCGGSLVSARVVISSA 294

  Fly   215 HCLTTHG---TSPDI-VKIGDIKLKEWELN---VAPQRRRVAQIYLHPLYNASLNYH--DIGLIQ 270
            ||.....   ||.:: |.:|...||.|...   .||    |..||:||.:|:.|:.:  ||.:|.
  Fly   295 HCFKLFNKRYTSNEVLVFLGRHNLKNWNEEGSLAAP----VDGIYIHPDFNSQLSSYDADIAVII 355

  Fly   271 LNRPVEYTWFVRPVRLWPMNDIPYGKLHTMGYGST-----------GFAQPQTNILTELDLSVVP 324
            |...|.:..|:||..||            .|...|           |::..:||...:..||   
  Fly   356 LKDEVRFNTFIRPACLW------------SGSSKTEYIVGERGIVIGWSFDRTNRTRDQKLS--- 405

  Fly   325 IEQCNSSLP----ADEGSPHGL-------------------LTSQ--ICAHDYEKNRDTCQ---- 360
                 |.||    .|..:|..:                   |:|.  .||....:.|||.|    
  Fly   406 -----SELPGKKSTDASAPKVVKAPIVGNAECFRANAHFRSLSSNRTFCAGIQAEERDTHQSGAS 465

  Fly   361 ---GDSGGPLQLNLERRRRRHTSRKHYRYYLVGI------TSYGAYCRSELPGVYTRVSSYIDWI 416
               |.||..|.:   ||..|...|......|..:      :|:...|:::.. :|..|:.::|||
  Fly   466 IYTGISGAGLFI---RRNNRWMLRGTVSAALPAVETPDAESSHKLCCKNQYI-IYADVAKFLDWI 526

  Fly   417 ASIV 420
            .:.|
  Fly   527 TAFV 530

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11670NP_001368950.1 Tryp_SPc 172..419 CDD:238113 79/314 (25%)
gdNP_001259479.1 GD_N 27..124 CDD:292649
Tryp_SPc 257..526 CDD:238113 76/297 (26%)
Tryp_SPc 258..526 CDD:214473 76/296 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45456106
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24258
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.