DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11670 and spirit

DIOPT Version :9

Sequence 1:NP_001368950.1 Gene:CG11670 / 41608 FlyBaseID:FBgn0038114 Length:431 Species:Drosophila melanogaster
Sequence 2:NP_001162707.1 Gene:spirit / 31797 FlyBaseID:FBgn0030051 Length:393 Species:Drosophila melanogaster


Alignment Length:334 Identity:112/334 - (33%)
Similarity:165/334 - (49%) Gaps:54/334 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   108 CPGGPGGPLQHRQWDNGPRQWQPRRPPPN---HHRNFHNI--------FLNTESKVDGENYNKTA 161
            ||....|             |..||..|.   ..|..|.:        .:...|:......||.:
  Fly    69 CPSALNG-------------WLERRESPKTCYFVRFDHYVCCAPAVAPIVTRSSQQACNELNKVS 120

  Fly   162 ETEDLHDDFNGRSIVA-----PGQYPHMAALGFR-NENHEIDYKCGGSLISEEFVLTAAHCLTTH 220
            :.:::.:.|  .|:|.     |.::|.|||||:| |.:..|.|:|||:||:..||||||||....
  Fly   121 KVKEIDEFF--VSVVGGMPTRPREFPFMAALGWRSNFDQRIYYRCGGALIANNFVLTAAHCADLG 183

  Fly   221 GTSPDIVKIG--DIKLKEWELNVAPQRRRVAQIYLHPLYNASLNYHDIGLIQLNRPVEYTWFVRP 283
            |..|..|::|  ::.|.|.| :::     :.::.:||.|:||..|:||.|::|....:..  ::|
  Fly   184 GEPPSQVRLGGDNLTLTEGE-DIS-----IRRVIIHPDYSASTAYNDIALLELETAAKPE--LKP 240

  Fly   284 VRLWPMNDIPYGKLHTMGYGSTGFAQPQTNILTELDLSVVPIEQCNSSLPADEGSPHGLLTSQIC 348
            ..:|...::....:..:|||.|.||...:..|.::.|..|..|:|......|: ...|:|.:|:|
  Fly   241 TCIWTQKEVTNTLVTAIGYGQTSFAGLSSAQLLKVPLKSVSNEECQHHYQKDQ-LAQGVLGTQMC 304

  Fly   349 AHDYEKNRDTCQGDSGGPLQLNLERRRRRHTSRKHYRYYLVGITSYGAYCRSELPGVYTRVSSYI 413
            |.|....||||||||||||.:           :.....|:|||||.|..|.|..|.|||||||::
  Fly   305 AGDITGERDTCQGDSGGPLLM-----------QDGLLGYVVGITSLGQGCASGPPSVYTRVSSFV 358

  Fly   414 DWIASIVWP 422
            |||..||||
  Fly   359 DWIEGIVWP 367

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11670NP_001368950.1 Tryp_SPc 172..419 CDD:238113 95/254 (37%)
spiritNP_001162707.1 CLIP 51..98 CDD:197829 9/41 (22%)
Tryp_SPc 132..364 CDD:238113 94/251 (37%)
Tryp_SPc 132..361 CDD:214473 92/248 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D105391at6960
OrthoFinder 1 1.000 - - FOG0012732
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.