DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11670 and CG1632

DIOPT Version :9

Sequence 1:NP_001368950.1 Gene:CG11670 / 41608 FlyBaseID:FBgn0038114 Length:431 Species:Drosophila melanogaster
Sequence 2:NP_001245577.1 Gene:CG1632 / 31763 FlyBaseID:FBgn0030027 Length:1056 Species:Drosophila melanogaster


Alignment Length:382 Identity:69/382 - (18%)
Similarity:118/382 - (30%) Gaps:155/382 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly   170 FNGR------SIVAPGQYPHMAALGFRNENHEIDYKCGGSLISEEFVLTAAHCLTTHGTSPDIVK 228
            ||.:      .:.|||.:|.:.|| ||.:.|    .|.|:||::::|||...|......:..:..
  Fly   696 FNAKQHLSLPKMSAPGDWPWLVAL-FREDIH----VCDGTLITQDWVLTTEGCFQGQPRATWMAI 755

  Fly   229 IGDIKLK---EWELNVAPQRRRVAQIYLHPLYNASLNYHDIGLIQLNRPVEYTWFVRPVRL---- 286
            :|.::|.   .|     .||||:..:...|:..::     ..|::|..||.|:..|||:.|    
  Fly   756 VGAVRLSAKAPW-----TQRRRIIGMIKSPVEGST-----AALVRLETPVSYSDHVRPICLPDAL 810

  Fly   287 ---------------WPMNDIPYGKL--------------------------------------- 297
                           .|:.:...|:|                                       
  Fly   811 QRRLLQQPPAQRRSHVPVAERLEGQLVSQQRSRLSQENQQFFLIPSQEQQDSSTENQGDEDQDEQ 875

  Fly   298 --HTMGYGSTGFAQPQTNILTELD-----------------------------------LSVVPI 325
              |..|..:..:......:..|||                                   |:.||.
  Fly   876 EDHFGGESAASYMPKAEALHQELDGYPLPDHAPQVNYYSSSSTVTSSSTAARIATKAPILAAVPA 940

  Fly   326 EQ------CNS------------------SLPADEGSPHGLLTSQICAHDYEKNRDTCQGDSGGP 366
            .|      ||:                  .:...|......:.|......|:|...|.:..||.|
  Fly   941 AQEQIWTNCNTLGWSRQRDHLQRVQLKMGDMAPCENVSIATVNSMCMEATYQKYDCTQEEYSGAP 1005

  Fly   367 LQLNLERRRRRHTSRKHYRYYLVGITSYGAYCRS---ELPGVYTRVSSYIDWIASIV 420
            :|..:....         ::.|:|::|:...|..   |.|.:|.:::|...||...:
  Fly  1006 VQCLIPGTN---------QWALIGVSSWRIACGPTGVERPRMYDKIASNAAWIRETI 1053

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11670NP_001368950.1 Tryp_SPc 172..419 CDD:238113 67/377 (18%)
CG1632NP_001245577.1 SEA 232..327 CDD:279699
CRD_FZ 384..502 CDD:143549
PRKCSH-like <503..>582 CDD:193472
LDLa 536..571 CDD:238060
Tryp_SPc 708..>809 CDD:304450 34/115 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24258
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.