DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11670 and GZMK

DIOPT Version :9

Sequence 1:NP_001368950.1 Gene:CG11670 / 41608 FlyBaseID:FBgn0038114 Length:431 Species:Drosophila melanogaster
Sequence 2:NP_002095.1 Gene:GZMK / 3003 HGNCID:4711 Length:264 Species:Homo sapiens


Alignment Length:269 Identity:75/269 - (27%)
Similarity:118/269 - (43%) Gaps:41/269 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   167 HDDFN----GRSIVAPGQYPHMAALGFRNENHEIDYKCGGSLISEEFVLTAAHC--LTTHGTSPD 225
            |..||    |...|:|...|.||::.:  ..|.:   |||.||..::|||||||  ..|.|.||.
Human    20 HVCFNMEIIGGKEVSPHSRPFMASIQY--GGHHV---CGGVLIDPQWVLTAAHCQYRFTKGQSPT 79

  Fly   226 IVKIGDIKLKEWELNVAPQRRRVAQIYLHPLYNASLNYHDIGLIQLNRPVEYTWFVRPVRLWPMN 290
            :| :|...|.:.|  .:.|...:.:........:....:||.|::|....:....|:.:.:....
Human    80 VV-LGAHSLSKNE--ASKQTLEIKKFIPFSRVTSDPQSNDIMLVKLQTAAKLNKHVKMLHIRSKT 141

  Fly   291 DIPYG-KLHTMGYGSTGFAQPQ----TNILTELDLSVVPIEQCNSSLPADEGSPHGLLTSQICAH 350
            .:..| |....|:|:|   .|.    ::.|.|:.::|:..:.|||. ....|.|. :....:||.
Human   142 SLRSGTKCKVTGWGAT---DPDSLRPSDTLREVTVTVLSRKLCNSQ-SYYNGDPF-ITKDMVCAG 201

  Fly   351 DYEKNRDTCQGDSGGPLQLNLERRRRRHTSRKHYRYYLVGITSYGAYCR-SELPGVYTRVS-SYI 413
            |.:..:|:|:|||||||..               :.....|.|.|..|. :..||:||.:: .|.
Human   202 DAKGQKDSCKGDSGGPLIC---------------KGVFHAIVSGGHECGVATKPGIYTLLTKKYQ 251

  Fly   414 DWIASIVWP 422
            .||.|.:.|
Human   252 TWIKSNLVP 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11670NP_001368950.1 Tryp_SPc 172..419 CDD:238113 70/255 (27%)
GZMKNP_002095.1 Tryp_SPc 26..254 CDD:214473 68/255 (27%)
Tryp_SPc 27..257 CDD:238113 70/257 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1144875at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.