DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11670 and Gzma

DIOPT Version :9

Sequence 1:NP_001368950.1 Gene:CG11670 / 41608 FlyBaseID:FBgn0038114 Length:431 Species:Drosophila melanogaster
Sequence 2:NP_703198.1 Gene:Gzma / 266708 RGDID:628640 Length:261 Species:Rattus norvegicus


Alignment Length:253 Identity:69/253 - (27%)
Similarity:117/253 - (46%) Gaps:38/253 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   172 GRSIVAPGQYPHMAALGFRNENHEIDYKCGGSLISEEFVLTAAHCLTTHGTSPDIVKIGDIKLKE 236
            |...|.|...|:|..|..:.     |..|.|:||::.:|||||||:.  |...::: :|...:|:
  Rat    31 GGDTVVPHSRPYMVLLKLKP-----DSICAGALIAKNWVLTAAHCIP--GKKSEVI-LGAHSIKK 87

  Fly   237 WELNVAPQRR--RVAQIYLHPLYNASLNYHDIGLIQLNRPVEYTWFVRPVRLWPMND--IPYGKL 297
                 .|:::  .|.:.|.:|.::...:..|:.|::|.:.......|..:.|....|  .|..:.
  Rat    88 -----EPEQQILSVKKAYPYPCFDKHTHEGDLQLLRLKKKATLNKNVAILHLPKKGDDVKPGTRC 147

  Fly   298 HTMGYGSTGFAQPQTNILTELDLSVVPIEQCNSSLPADEGSPHGLLTSQICAHDYEKNRDTCQGD 362
            |..|:|......|.::.|.|::::|:..:.||.....:.....||  :.|||.:....:|:|.||
  Rat   148 HVAGWGRFHNKSPPSDTLREVNITVIDRKICNDEKHYNFNPVIGL--NMICAGNLRGGKDSCYGD 210

  Fly   363 SGGPLQLNLERRRRRHTSRKHYRYYLVGITSYGAYCR---SELPGVYTRVS-SYIDWI 416
            |||||......|               |||::|...|   .:.||:||.:| .::|||
  Rat   211 SGGPLLCEGIFR---------------GITAFGLEGRCGDPKGPGIYTLLSDKHLDWI 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11670NP_001368950.1 Tryp_SPc 172..419 CDD:238113 69/253 (27%)
GzmaNP_703198.1 Tryp_SPc 28..253 CDD:214473 67/251 (27%)
Tryp_SPc 29..256 CDD:238113 69/253 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D476534at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.