DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11670 and CG30375

DIOPT Version :9

Sequence 1:NP_001368950.1 Gene:CG11670 / 41608 FlyBaseID:FBgn0038114 Length:431 Species:Drosophila melanogaster
Sequence 2:NP_724665.1 Gene:CG30375 / 246575 FlyBaseID:FBgn0050375 Length:398 Species:Drosophila melanogaster


Alignment Length:255 Identity:76/255 - (29%)
Similarity:128/255 - (50%) Gaps:30/255 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   171 NGRSIVAPGQYPHMAALGFRNENHEIDYKCGGSLISEEFVLTAAHCLTTHGTSPDIVK-IGDIKL 234
            ||   |..|::...:.:|.|:.:..:...||||::||.:::|||||......:..::. :|:..|
  Fly   154 NG---VEAGKHEFPSMVGLRDLSSNLPIFCGGSIVSERYIMTAAHCTARQPVASRLLALVGEHDL 215

  Fly   235 KEWELNVAPQRRRVAQIYLHPLY--NASLNYHDIGLIQLNRPVEYTWFVRPVRLWPM----NDIP 293
            .....::...:.|:..|..||.|  .||.|.:||.|:|...|:|::..|.|:.| |:    |...
  Fly   216 STGAESIYAAQYRIQNIINHPGYMETASGNINDIALLQTATPIEWSRGVAPICL-PIRQAENSFN 279

  Fly   294 YGKLHTMGYGSTGFAQPQTNILTELDLSVVPIEQCNSSLPADEGSPHGLLTSQICAHDY-EKNRD 357
            |..:..||:|:.|||..::|.|.:..|..:....|.|...:      .:..|.:|.:|. .:.:|
  Fly   280 YQNVDIMGWGTLGFAASKSNTLQKATLLTMDNAVCRSRFNS------SITPSHLCTYDAGGRGQD 338

  Fly   358 TCQGDSGGPLQLNLERRRRRHTSRKHYRYYLVGITSYGAYCRSELP-GVYTRVSSYIDWI 416
            :||.|||||:.|           |:..|.:.:|:.|||..|..... ||.|||:|:::|:
  Fly   339 SCQYDSGGPVIL-----------RQRERMFQLGVISYGRACGQPFGIGVNTRVTSHLNWL 387

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11670NP_001368950.1 Tryp_SPc 172..419 CDD:238113 75/254 (30%)
CG30375NP_724665.1 CUB 38..>100 CDD:294042
Tryp_SPc 151..386 CDD:214473 75/252 (30%)
Tryp_SPc 152..387 CDD:238113 75/253 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45455985
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24258
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.