DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11670 and svh-1

DIOPT Version :9

Sequence 1:NP_001368950.1 Gene:CG11670 / 41608 FlyBaseID:FBgn0038114 Length:431 Species:Drosophila melanogaster
Sequence 2:NP_501379.2 Gene:svh-1 / 182375 WormBaseID:WBGene00006620 Length:951 Species:Caenorhabditis elegans


Alignment Length:255 Identity:73/255 - (28%)
Similarity:124/255 - (48%) Gaps:41/255 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   178 PGQYPHMAALGFRNENHEIDYKCGGSLISEEFVLTAAHCLTTHGTSPDIVKIGDIKLKEWELNVA 242
            ||.:|..|||  ||:..:. :.||.|::.:..::|||||.    ...:.|...::.:.:|:.|..
 Worm   721 PGAFPWTAAL--RNKATKA-HHCGASILDKTHLITAAHCF----EEDERVSSYEVVVGDWDNNQT 778

  Fly   243 PQRRRV---AQIYLHPLYNASLNYHDIGLIQLNRP-VEYTWFVRPVRLWPMNDIPY--GKLHTM- 300
            ....::   .:|:.:|||. .:..|||.::::..| :|:..:.:|:.| |..|..|  |:...: 
 Worm   779 DGNEQIFYLQRIHFYPLYK-DIFSHDIAILEIPYPGIEFNEYAQPICL-PSKDFVYTPGRQCVVS 841

  Fly   301 GYGSTGFAQPQTNILTELDLSVVPI----EQCNSSLPADEGSPHGLLTSQICAHDYEKNRDTCQG 361
            |:||.|....:     .|..:::||    :..|||......|     .|..||...|...|:|||
 Worm   842 GWGSMGLRYAE-----RLQAALIPIINRFDCVNSSQIYSSMS-----RSAFCAGYLEGGIDSCQG 896

  Fly   362 DSGGPLQLNLERRRRRHTSRKHYRYYLVGITSYGAYC-RSELPGVYTRVSSYIDWIASIV 420
            |||||....          |:...:.|.|:.|:|..| :.:.||:||.|:.|:.||::|:
 Worm   897 DSGGPFACR----------REDGAFVLAGVISWGDGCAQKKQPGIYTMVAPYLSWISAII 946

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11670NP_001368950.1 Tryp_SPc 172..419 CDD:238113 72/252 (29%)
svh-1NP_501379.2 KR 227..306 CDD:214527
LDLa 320..355 CDD:238060
PAN_AP_HGF 373..434 CDD:238532
LDLa 558..590 CDD:197566
SRCR_2 599..681 CDD:382996
Tryp_SPc 713..945 CDD:238113 72/252 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24258
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.