DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11670 and Gzmk

DIOPT Version :9

Sequence 1:NP_001368950.1 Gene:CG11670 / 41608 FlyBaseID:FBgn0038114 Length:431 Species:Drosophila melanogaster
Sequence 2:NP_032222.1 Gene:Gzmk / 14945 MGIID:1298232 Length:263 Species:Mus musculus


Alignment Length:278 Identity:82/278 - (29%)
Similarity:128/278 - (46%) Gaps:53/278 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   163 TEDLHDDFNGRSIVAPGQYPHMAALGFRNENHEIDYKCGGSLISEEFVLTAAHCLT--THGTSPD 225
            :|..|.:..|...|.|...|.||::.:|::     :.|||.||..::|||||||.:  ..|.||.
Mouse    19 SECFHTEIIGGREVQPHSRPFMASIQYRSK-----HICGGVLIHPQWVLTAAHCYSWFPRGHSPT 78

  Fly   226 IVKIGDIKLKEWELNVAPQRRRVAQIYLHP---LYNASLNYHDIGLIQLNRPVEYTWFVRPVRLW 287
            :| :|...|.:.|    |.::........|   |.:.|.: |||.||:|....|....|:.:.|.
Mouse    79 VV-LGAHSLSKNE----PMKQTFEIKKFIPFSRLQSGSAS-HDIMLIKLRTAAELNKNVQLLHLG 137

  Fly   288 PMNDIPYG-KLHTMGYGSTGFAQPQ----TNILTELDLSVVPIEQCNSS-----LPADEGSPHGL 342
            ..|.:..| |....|:|:|   :|.    ::.|.|:.::::..::|||.     .|.       :
Mouse   138 SKNYLRDGTKCQVTGWGTT---KPDLLTASDTLREVTVTIISRKRCNSQSYYNHKPV-------I 192

  Fly   343 LTSQICAHDYEKNRDTCQGDSGGPLQLNLERRRRRHTSRKHYRYYLVGITSYGAYCR-SELPGVY 406
            ....|||.|....:|:|:|||||||..            |...:.||   |.|..|. ::.||:|
Mouse   193 TKDMICAGDARGQKDSCKGDSGGPLIC------------KGIFHALV---SQGYKCGIAKKPGIY 242

  Fly   407 TRVS-SYIDWIASIVWPN 423
            |.:: .|..||.|.:.|:
Mouse   243 TLLTKKYQTWIKSKLAPS 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11670NP_001368950.1 Tryp_SPc 172..419 CDD:238113 78/263 (30%)
GzmkNP_032222.1 Tryp_SPc 25..253 CDD:214473 76/263 (29%)
Tryp_SPc 26..256 CDD:238113 78/265 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D476534at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.