DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11670 and LOC101886682

DIOPT Version :9

Sequence 1:NP_001368950.1 Gene:CG11670 / 41608 FlyBaseID:FBgn0038114 Length:431 Species:Drosophila melanogaster
Sequence 2:XP_005170582.2 Gene:LOC101886682 / 101886682 -ID:- Length:252 Species:Danio rerio


Alignment Length:248 Identity:75/248 - (30%)
Similarity:115/248 - (46%) Gaps:40/248 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   178 PGQYPHMAALGFRNENHEIDYKCGGSLISEEFVLTAAHCLTTHGTSPDIVKIGDIKLKEWELNVA 242
            |...|:|.:|...::     :.|||||||:|||||||||.........:....|::.|     ..
Zfish    35 PHSRPYMVSLQINSQ-----HICGGSLISKEFVLTAAHCWDKDDVLTVVTGAHDLRKK-----AI 89

  Fly   243 PQRRRVAQIYLHPLYNASLNYHDIGLIQLNRPVEYTWFVRPVRLWPMN--DIPYGKLHTM-GYGS 304
            ....:|.....||.||:....:||.|::|...|..:..|..:.| |.|  |:....|.:: |:|.
Zfish    90 YNTFKVTSYIPHPDYNSYTLENDIMLLKLKTKVRLSNSVGLISL-PRNGEDLKADTLCSIAGWGR 153

  Fly   305 TGFAQPQTNILTELDLSVVPIEQCNSSLPADEGSPHGLLTSQICAHDYEKNRDTCQGDSGGPLQL 369
            ......:|:.|.|.:..:|...:|.....:|.     :.:..|||:.:   ..||.|||||||..
Zfish   154 LWRKGAKTDRLREAETVIVNDAECERRWESDY-----VASKMICAYGH---GGTCSGDSGGPLVC 210

  Fly   370 NLERRRRRHTSRKHYRYYLVGITSYG--AYCRSEL-PGVYTRVSSYIDWIASI 419
            |       :|:        ||||::.  ..|:|.| |.|:.|:|:|:.||.:|
Zfish   211 N-------NTA--------VGITAFSDRYLCKSRLFPDVFARISAYLPWIQNI 248

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11670NP_001368950.1 Tryp_SPc 172..419 CDD:238113 74/246 (30%)
LOC101886682XP_005170582.2 Tryp_SPc 27..248 CDD:238113 74/246 (30%)
Tryp_SPc 27..245 CDD:214473 72/243 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D476534at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.