DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11670 and gzma

DIOPT Version :9

Sequence 1:NP_001368950.1 Gene:CG11670 / 41608 FlyBaseID:FBgn0038114 Length:431 Species:Drosophila melanogaster
Sequence 2:XP_012808240.1 Gene:gzma / 100135014 XenbaseID:XB-GENE-482759 Length:267 Species:Xenopus tropicalis


Alignment Length:264 Identity:81/264 - (30%)
Similarity:122/264 - (46%) Gaps:47/264 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   168 DDFNGRSIVAPGQYPHMAALGFRNENHEIDYKCGGSLISEEFVLTAAHCLTTHGTSPDIVKIGDI 232
            |..:||. .|....|:||.:..|..:      |||:||.:.:|||||||:..:..    |.:|..
 Frog    34 DIIDGRE-AASHSRPYMAYIYSRTGS------CGGTLIKQNWVLTAAHCVVNNSE----VILGAH 87

  Fly   233 KLKEWELNVAPQRRRVAQIYLHPLYNASLNYHDIGLIQLNRPVEYTWFVRPVRLWPMNDI---PY 294
            |:|..|..  .||..||:...||.:......|||.|:|:....:...||..::| |..|:   |.
 Frog    88 KVKSRENE--QQRFSVARAIPHPCFEWKKKIHDIQLLQIKGAAKLNKFVSVLKL-PTTDMDVKPG 149

  Fly   295 GKLHTMGYGSTGFAQPQ----TNILTELDLSVVPIEQCNSSLPADEGSPHGLLTSQICA---HDY 352
            ....|.|:|.|   :|.    :::|.|::::||....||......:..   :.|:.:||   ...
 Frog   150 SSCSTAGWGVT---KPNGKTPSDVLREVNVTVVDRGTCNKIYKKFKTE---ISTNMLCAGAPKKS 208

  Fly   353 EKNRDTCQGDSGGPLQLNLERRRRRHTSRKHYRYYLVGITSYGAYCRS-ELPGVYTRVSS-YIDW 415
            :|..|.|||||||||....|               ..||.|:|..|.. :.||:|||::: |:.|
 Frog   209 DKKYDACQGDSGGPLICGKE---------------FSGIVSFGKKCGDPKYPGIYTRLTARYLQW 258

  Fly   416 IASI 419
            |..:
 Frog   259 IRDV 262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11670NP_001368950.1 Tryp_SPc 172..419 CDD:238113 80/258 (31%)
gzmaXP_012808240.1 Tryp_SPc 35..262 CDD:238113 80/261 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D476534at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.