DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment snk and Tmprss12

DIOPT Version :9

Sequence 1:NP_001097766.1 Gene:snk / 41607 FlyBaseID:FBgn0003450 Length:435 Species:Drosophila melanogaster
Sequence 2:NP_898932.2 Gene:Tmprss12 / 75002 MGIID:1922252 Length:336 Species:Mus musculus


Alignment Length:249 Identity:81/249 - (32%)
Similarity:129/249 - (51%) Gaps:20/249 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   186 IVGGTPTRHGLFPHMAALGWTQGSGSKDQDIKWG-CGGALVSELYVLTAAHCATSGSKPPDMVR- 248
            |:||:....|.:|      |......:|.||... ||||||.:.:||||||| |..::.|...| 
Mouse    66 IIGGSQADTGAWP------WQVSLQVQDGDILMHVCGGALVRDRWVLTAAHC-TKEARDPLKWRA 123

  Fly   249 -LGARQLNETSATQQDIKILIIVLHPKYRSSAYYHDIALLKLTRRVKFSEQVRPACL----WQLP 308
             :|...|..:....::|:|..|::.|.:....:.:||||.:|.|.|::::.::|.||    :|..
Mouse   124 VMGTNDLTRSPYHSRNIRITDIIIPPDFIMETFVNDIALFRLKRAVRYNDYIQPICLPFGVFQKL 188

  Fly   309 ELQIPTVVAAGWGRTEFLGAKSNALRQVDLDVVPQMTCKQIYRKERRLPRGIIEGQFCAGYLPGG 373
            : |......:|||||...|..:..|::..:..:.:..|.........:|    ...||||:..|.
Mouse   189 D-QNTACFISGWGRTREEGNGTTILQEAKVHFISREVCSSDQGYSGMIP----NTSFCAGHENGT 248

  Fly   374 RDTCQGDSGGPIHALLPEYNCVAFVVGITSFGKFCAAPNAPGVYTRLYSYLDWI 427
            .|:|:||||||:...|||::.. ||:||||:|..|...:.||||:....:.:|:
Mouse   249 FDSCRGDSGGPLMCYLPEHSRY-FVMGITSYGHGCGRRHFPGVYSNPSFFQEWM 301

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
snkNP_001097766.1 CLIP 93..139 CDD:197829
Tryp_SPc 186..430 CDD:238113 81/249 (33%)
Tryp_SPc 186..427 CDD:214473 80/247 (32%)
Tmprss12NP_898932.2 Tryp_SPc 65..300 CDD:214473 80/246 (33%)
Tryp_SPc 66..300 CDD:238113 80/246 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BF5U
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.