DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment snk and CG34409

DIOPT Version :9

Sequence 1:NP_001097766.1 Gene:snk / 41607 FlyBaseID:FBgn0003450 Length:435 Species:Drosophila melanogaster
Sequence 2:NP_001097728.2 Gene:CG34409 / 5740854 FlyBaseID:FBgn0085438 Length:511 Species:Drosophila melanogaster


Alignment Length:269 Identity:80/269 - (29%)
Similarity:122/269 - (45%) Gaps:44/269 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   186 IVGGTPTRHGLFPHMAALGWTQGSGSKDQDIKWGCGGALVSELYVLTAAHCATSGSKPPDM--VR 248
            ::||.....|.||.:..:.:...|.|:   |.:.|.|:|:|..:::|||||..:.....::  ||
  Fly   250 LLGGDQASAGQFPWLTRIAYRNRSSSR---ISFRCSGSLISSNHIVTAAHCVVNLVSDLELSHVR 311

  Fly   249 LGARQLNETSATQQDIKILIIVLHPKYRSSAYYHDIALLKLTRRVKFSEQVRPACL-----WQLP 308
            ||::......|.:|      :::||.|....|.:|||||::.   ..:....|.||     ..|.
  Fly   312 LGSQDGATPFAIEQ------VIVHPNYDQPKYANDIALLRIN---STNGTFTPICLPFNGPITLG 367

  Fly   309 ELQIPTV-VAAGW--GRTEFLGA--KSNA---LRQVDLDVVPQMTCKQIY---RKERRLPRGIIE 362
            ...|..: |||||  |.||...:  .||:   :|.:.|.:|...:|...|   .:..:.|..|..
  Fly   368 NRLIGQIGVAAGWSIGSTENNSSMDPSNSTAGVRFIRLPIVNTTSCAIAYASLSENFQQPIVITP 432

  Fly   363 GQFCAGYLPGGRDTCQGDSGGP--------IHALLPEYNCVAFVVGITSFG-KFCAAPNAPGVYT 418
            ...||..:| ..|.|:||||||        :......|.    ::||.:|| ..|.....|||||
  Fly   433 NHLCAQGMP-MNDVCRGDSGGPFMDDGTSGVFGTSGRYT----IIGIVAFGPTLCGVTTIPGVYT 492

  Fly   419 RLYSYLDWI 427
            .:.|:.|||
  Fly   493 LVSSFSDWI 501

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
snkNP_001097766.1 CLIP 93..139 CDD:197829
Tryp_SPc 186..430 CDD:238113 80/269 (30%)
Tryp_SPc 186..427 CDD:214473 78/267 (29%)
CG34409NP_001097728.2 CLIP 26..71 CDD:288855
Tryp_SPc 249..501 CDD:214473 78/267 (29%)
Tryp_SPc 252..501 CDD:238113 78/265 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437431
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
43.940

Return to query results.
Submit another query.