DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment snk and Jon99Cii

DIOPT Version :9

Sequence 1:NP_001097766.1 Gene:snk / 41607 FlyBaseID:FBgn0003450 Length:435 Species:Drosophila melanogaster
Sequence 2:NP_524554.1 Gene:Jon99Cii / 43544 FlyBaseID:FBgn0003356 Length:265 Species:Drosophila melanogaster


Alignment Length:260 Identity:75/260 - (28%)
Similarity:119/260 - (45%) Gaps:56/260 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   186 IVGGTPTRHGLFPHMAALGWTQGSGSKDQDIKWGCGGALVSELYVLTAAHCATSGSKPPDMVRLG 250
            |..|.|...|..|::..|.:: |:|:      |.|||:::...:|||||||....|..  .:..|
  Fly    36 ITNGYPAYEGKVPYIVGLLFS-GNGN------WWCGGSIIGNTWVLTAAHCTNGASGV--TINYG 91

  Fly   251 ARQLNETSATQQDIKILI----IVLHPKYRSSAYYHDIALLKLTRRVKFSEQVRPACLWQL-PEL 310
            |     :..||......:    |:.|..|.|...::||:|:: |..|.|         |.| .::
  Fly    92 A-----SIRTQPQYTHWVGSGDIIQHHHYNSGNLHNDISLIR-TPHVDF---------WSLVNKV 141

  Fly   311 QIPT------------VVAAGWGRTEFLGAKSNALRQVDLDVVPQMTCKQIYRKERRLPRGIIEG 363
            ::|:            .||:|||.|.......:.|:.||:.::.|..|.:.:        .:.:.
  Fly   142 ELPSYNDRYQDYAGWWAVASGWGGTYDGSPLPDWLQSVDVQIISQSDCSRTW--------SLHDN 198

  Fly   364 QFCAGYLPGGRDTCQGDSGGPIHALLPEYNCVAFVVGITSFGKFCAAPN-APGVYTRLYSYLDWI 427
            ..|.. ..||:.||.||||||:  :..:.|   .:||:||||......: ||.|::|:..|||||
  Fly   199 MICIN-TDGGKSTCGGDSGGPL--VTHDGN---RLVGVTSFGSAAGCQSGAPAVFSRVTGYLDWI 257

  Fly   428  427
              Fly   258  257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
snkNP_001097766.1 CLIP 93..139 CDD:197829
Tryp_SPc 186..430 CDD:238113 75/260 (29%)
Tryp_SPc 186..427 CDD:214473 73/258 (28%)
Jon99CiiNP_524554.1 Tryp_SPc 36..260 CDD:238113 75/260 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437008
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
43.940

Return to query results.
Submit another query.