DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment snk and CG11841

DIOPT Version :9

Sequence 1:NP_001097766.1 Gene:snk / 41607 FlyBaseID:FBgn0003450 Length:435 Species:Drosophila melanogaster
Sequence 2:NP_651661.1 Gene:CG11841 / 43430 FlyBaseID:FBgn0039628 Length:319 Species:Drosophila melanogaster


Alignment Length:293 Identity:102/293 - (34%)
Similarity:147/293 - (50%) Gaps:13/293 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly   149 RISATKCQEY---NAAARRLHLTDTGRTF-SGKQCVPSVPLIVGGTPTRHGLFPHMAALGWTQGS 209
            :::.||.::.   ...|.....||...|: :...|..|.||||.|||.....||..|.||..:  
  Fly    31 QLACTKFKQIVFEERVAISFFFTDAPITYETVDSCHGSRPLIVDGTPAEPKEFPFAARLGHRK-- 93

  Fly   210 GSKDQDIKWGCGGALVSELYVLTAAHCATSGSKPPDMVRLGARQLNETS--ATQQDIKILIIVLH 272
              .:.:|||.|||.|:|...|||||||..|.....::||||..:.:..:  |..:|..:|.:..|
  Fly    94 --TNNEIKWFCGGTLISNRLVLTAAHCFFSEHGEVNVVRLGELEFDTDTDDAEPEDFGVLALKAH 156

  Fly   273 PKYRSSAYYHDIALLKLTRRVKFSEQVRPACLWQLPELQIPTVVAAGWGRTEFLGAKSNALRQVD 337
            |.:.:...|:||.:::|.|.|||:....||||......|..:.:|.|||:.:|...:|..|.:|.
  Fly   157 PGFENPQLYNDIGIVQLDREVKFNRYKHPACLPFDDGEQHESFIAIGWGQKKFAQKESKKLLKVQ 221

  Fly   338 LDVVPQMTCKQIYRKERRLPRGI-IEGQFCAGYLPGGRDTCQGDSGGPIHALLPEYNCVAFVVGI 401
            |..... .|.........||.|. .:.|.|.| ....:|||.||||||:.|...:..|:..|:||
  Fly   222 LQGYKD-RCVSSVDANDELPNGYEPKSQLCIG-SRDNKDTCNGDSGGPVLAYHKDLACMYHVMGI 284

  Fly   402 TSFGKFCAAPNAPGVYTRLYSYLDWIEKIAFKQ 434
            ||.|..|:.|:.|..|||::.:|:||:....||
  Fly   285 TSAGITCSTPDIPSAYTRVHYFLNWIKGELAKQ 317

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
snkNP_001097766.1 CLIP 93..139 CDD:197829
Tryp_SPc 186..430 CDD:238113 90/246 (37%)
Tryp_SPc 186..427 CDD:214473 88/243 (36%)
CG11841NP_651661.1 Tryp_SPc 72..311 CDD:238113 89/244 (36%)
Tryp_SPc 72..310 CDD:214473 88/243 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437675
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 119 1.000 Inparanoid score I4773
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D105391at6960
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
66.000

Return to query results.
Submit another query.